[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : AAZ22167.1
DDBJ      :             Glutaredoxin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:84 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->72 2klxA PDBj 1e-14 44.3 %
:RPS:PDB   4->72 3d5jB PDBj 7e-12 20.3 %
:RPS:SCOP  3->67 1h75A  c.47.1.1 * 5e-16 30.2 %
:HMM:SCOP  1->86 1j0fA_ c.47.1.14 * 4.6e-22 36.0 %
:RPS:PFM   4->64 PF00462 * Glutaredoxin 2e-09 40.0 %
:HMM:PFM   4->64 PF00462 * Glutaredoxin 9.7e-20 40.0 60/60  
:BLT:SWISS 1->72 GLRX3_ECOLI 1e-12 46.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22167.1 GT:GENE AAZ22167.1 GT:PRODUCT Glutaredoxin GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1298056..1298310 GB:FROM 1298056 GB:TO 1298310 GB:DIRECTION + GB:PRODUCT Glutaredoxin GB:PROTEIN_ID AAZ22167.1 GB:DB_XREF GI:71063164 LENGTH 84 SQ:AASEQ MKNVTIYTGPLCNFCDAAKRLLARNNVEYKEINIATVDGAMDEMITKANGKRTIPQIFFDDNHIGGYDDVRALEKENKLLELLK GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|GLRX3_ECOLI|1e-12|46.5|71/83| SEG 73->83|lekenkllell| BL:PDB:NREP 1 BL:PDB:REP 1->72|2klxA|1e-14|44.3|70/89| RP:PDB:NREP 1 RP:PDB:REP 4->72|3d5jB|7e-12|20.3|69/107| RP:PFM:NREP 1 RP:PFM:REP 4->64|PF00462|2e-09|40.0|60/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 4->64|PF00462|9.7e-20|40.0|60/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 3->67|1h75A|5e-16|30.2|63/76|c.47.1.1| HM:SCP:REP 1->86|1j0fA_|4.6e-22|36.0|86/100|c.47.1.14|1/1|Thioredoxin-like| OP:NHOMO 273 OP:NHOMOORG 255 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------42212221111-1-1112111112211-111111111---------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------11111111-2-11---11----------------11111111111-111111111111111112111111311------------111111111111-----1--1----1--11-1-111111----------1------1-2---------111-11---11111-----1---11--111111111---------1----------------------1-11--------------------------------2-11-11---------------------------------11--1111111111-11-1111111111111111111111-----1111111111111111111111111111111111111111--1111111111-1-1---------------111111111111--------11-111------------1------------11----------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 85.7 SQ:SECSTR cccEEEEEcTTcHHHHHHHHHHHTTccccGEGGGcTTHHHHHHHHHHHHccccccEEEETTEEEEcHHHHHH############ PSIPRED cccEEEEEccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccccccEEEEccEEEEcHHHHHHHHHcccHHHHHc //