[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : accA
DDBJ      :accA         acetyl-CoA carboxylase
Swiss-Prot:ACCA_PELUB   RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha;         Short=Acetyl-CoA carboxylase carboxyltransferase subunit alpha;         Short=ACCase subunit alpha;         EC=6.4.1.2;

Homologs  Archaea  0/68 : Bacteria  749/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:368 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->315 2f9yA PDBj 1e-64 47.5 %
:RPS:PDB   59->192 3buzA PDBj 3e-22 13.8 %
:RPS:SCOP  3->317 2f9yA1  c.14.1.4 * 3e-44 41.2 %
:HMM:SCOP  3->317 2f9yA1 c.14.1.4 * 3.8e-88 34.3 %
:RPS:PFM   3->148 PF03255 * ACCA 2e-33 45.5 %
:HMM:PFM   4->149 PF03255 * ACCA 1.3e-46 41.0 144/145  
:HMM:PFM   97->249 PF01039 * Carboxyl_trans 1.2e-23 25.0 144/493  
:BLT:SWISS 1->368 ACCA_PELUB 0.0 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21333.1 GT:GENE accA GT:PRODUCT acetyl-CoA carboxylase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 498707..499813 GB:FROM 498707 GB:TO 499813 GB:DIRECTION + GB:GENE accA GB:PRODUCT acetyl-CoA carboxylase GB:NOTE similar to carboxyltransferase alpha chain - Aquifex aeolicus GB:PROTEIN_ID AAZ21333.1 GB:DB_XREF GI:71062330 GB:GENE:GENE accA LENGTH 368 SQ:AASEQ MKNYLNFETDIKNLEIEIDKLKDPYNQDGLSEVDTKKISESQKEIDNKLQEIYSNLDPWQTTLVARHEDRPKAKFFIDNLFEDFIPLSGDRYYGEDKSVLAGFAKFDEKSVLVIGQEKGDSLESRIERNFGMMRPEGYRKTIRLMKLANKFNIPIISFIDTPGAYPGVGAEERGQAEAIAKSIECCMSLNVPTLAIVIGEGGSGGAIALASSNKVIMLENAIYSVISPEGCATILWRDPKRTLEAAKAMKLSSKDLLELKVIDEIIPEPIGGAHRDRDLILDNVRKSIEKNLNEFFNMSGEEIFNHRKNKFLTIGRSKGFVNQIDDLSTLSMKESKVNLFIKNFFKSKLNLAVLFGVIVLLGYFIFSL GT:EXON 1|1-368:0| SW:ID ACCA_PELUB SW:DE RecName: Full=Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Short=Acetyl-CoA carboxylase carboxyltransferase subunit alpha; Short=ACCase subunit alpha; EC=6.4.1.2; SW:GN Name=accA; OrderedLocusNames=SAR11_0511; SW:KW ATP-binding; Complete proteome; Cytoplasm; Fatty acid biosynthesis;Ligase; Lipid synthesis; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->368|ACCA_PELUB|0.0|100.0|368/368| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| TM:NTM 1 TM:REGION 348->368| SEG 195->212|aivigeggsggaialass| BL:PDB:NREP 1 BL:PDB:REP 3->315|2f9yA|1e-64|47.5|299/301| RP:PDB:NREP 1 RP:PDB:REP 59->192|3buzA|3e-22|13.8|123/413| RP:PFM:NREP 1 RP:PFM:REP 3->148|PF03255|2e-33|45.5|143/145|ACCA| HM:PFM:NREP 2 HM:PFM:REP 4->149|PF03255|1.3e-46|41.0|144/145|ACCA| HM:PFM:REP 97->249|PF01039|1.2e-23|25.0|144/493|Carboxyl_trans| RP:SCP:NREP 1 RP:SCP:REP 3->317|2f9yA1|3e-44|41.2|301/301|c.14.1.4| HM:SCP:REP 3->317|2f9yA1|3.8e-88|34.3|315/0|c.14.1.4|1/1|ClpP/crotonase| OP:NHOMO 798 OP:NHOMOORG 761 OP:PATTERN -------------------------------------------------------------------- 111-1-11111-1---111-1---11111111-1111222-111---1------1-----111--22111---------111211111--------1--111111111111111111111111112222221221211122---1211111111111111111111111111111111111111111111-111111111211111111111121112111211111111121111111111111111111111-111111-1-22111211111111111111111111111111111111111111111111111111111--11111111111111111111111----2111111111111------11111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-----------------------------11111111111111111111111111111112111111111111111111111111111111111121111111111----11111121111111111111111111--1111111111111111111111111111111111111-111111-1111111111-11-11111------11111111111111111-111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111---------------1-1-----------------------------------11- -----------1--------------------------------------------------------------------------------------------------------------------------------------------------1----------------111-----113--3-21------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 307 STR:RPRED 83.4 SQ:SECSTR ##ccccTTHcTTcHHHHHHHHHH######HcHHHHTTcTTcHHHHHHcGHHHTTcccHHHHHHHTTccccccEEEEEEEccGGGTcccccGGGcTTcTEHHHHHHHHHHHTTcEEEEcccccEEccTEEEEccccccGGGTTccEEEEHHEEEcTTccEEEGGGccccccccEEcEEEEEEEEEEEEETTEEEEEEEccccccGGGHHHHHccEEEEEcTTccccccHHHccHHHHHHHHcccccHHHHHcHHHHHHTcccccEEEccHHHHHHHHHHHHTTccccTHHHTHHTTcTEEHHHHHHHTHHHHHHcc##################################################### DISOP:02AL 38-39, 244-245| PSIPRED cccccHHHccHHHHHHHHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHHcccHHHHHHcccccccccHHHHHHHHHcccHHHcccccccccccEEEEEEEEccEEEEEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHcccccEEEEEcccEEEEEcHHHHHHHHHccHHHHHHHHHHHcccHHHHHHcccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //