[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : accB
DDBJ      :accB         acetyl-CoA carboxylase biotin carboxyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  477/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.84.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->141 3bdoA PDBj 2e-12 36.7 %
:RPS:PDB   64->141 3bdoA PDBj 7e-09 37.2 %
:RPS:SCOP  63->141 1bdoA  b.84.1.1 * 1e-08 36.7 %
:HMM:SCOP  62->141 1bdoA_ b.84.1.1 * 2.9e-20 33.8 %
:HMM:PFM   66->139 PF00364 * Biotin_lipoyl 2.6e-23 35.6 73/74  
:BLT:SWISS 11->141 BCCP_STRP6 1e-14 34.4 %
:PROS 97->114|PS00188|BIOTIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21546.1 GT:GENE accB GT:PRODUCT acetyl-CoA carboxylase biotin carboxyl carrier protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(709915..710340) GB:FROM 709915 GB:TO 710340 GB:DIRECTION - GB:GENE accB GB:PRODUCT acetyl-CoA carboxylase biotin carboxyl carrier protein GB:NOTE AccB GB:PROTEIN_ID AAZ21546.1 GB:DB_XREF GI:71062543 GB:GENE:GENE accB LENGTH 141 SQ:AASEQ MKIDKNIIKELTDYLNEFNLTEIEYTDKDTKIKVSKSNPTSSNQTVSVAASTPALDTVKSTVVSGTEVKSPIIGTAYLAAEPGGKKFVEVGKKIKKGETVMIVEAMKTMNHVPSTADGIIKEICVEDGQPVEYGQTIIIVE GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 11->141|BCCP_STRP6|1e-14|34.4|131/166| PROS 97->114|PS00188|BIOTIN|PDOC00167| SEG 83->98|ggkkfvevgkkikkge| BL:PDB:NREP 1 BL:PDB:REP 63->141|3bdoA|2e-12|36.7|79/82| RP:PDB:NREP 1 RP:PDB:REP 64->141|3bdoA|7e-09|37.2|78/82| HM:PFM:NREP 1 HM:PFM:REP 66->139|PF00364|2.6e-23|35.6|73/74|Biotin_lipoyl| RP:SCP:NREP 1 RP:SCP:REP 63->141|1bdoA|1e-08|36.7|79/80|b.84.1.1| HM:SCP:REP 62->141|1bdoA_|2.9e-20|33.8|80/80|b.84.1.1|1/1|Single hybrid motif| OP:NHOMO 482 OP:NHOMOORG 478 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------1---1-------------112-1-111--------1---------------------------1-1-111--111111-----1--1--1111----1----11-1---11-1-111-1--111111-1--------------------1-------1---1-------1---111111111111111--1----1--1--1-111111--1-1--1-111111111111111111111111111111-1111--111---1----------------1------------1-1-1111111--1------111-111111111112111111111111111111111-11-11-111111111211111111111111111111111111111111111111------------------------------1111111111111111111111111111111111111111-1111111111111-11111-1111111111111111----------------1--1----1111-----1---111111----------1-1---11-111-111-11111--------1---111-11111------11111111111111111-11111111111111111111111111-1111111111111111111111111-11111111111111111111111111--1-11-11-1----11111111111--11-1111111111111111111-1-11-1-111-1111111111--------------11-------------------------------------------------------1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 91.5 SQ:SECSTR ############ccccccccEEEEEETTTccEEEEEEcccccccEEEEEccccccccccccTTcccccccccccEEEccccTTccccccTTcEEcccccccEEEcTTccccccccccEEEEEccccccEEccccccccEEc DISOP:02AL 36-67| PSIPRED ccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEccccccccccccccccccccccccccccccEEEcccccEEEEcccccccEEEccccEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEccccEEEEEc //