[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : acpS
DDBJ      :acpS         Holo-[acyl-carrier protein] synthase  (Holo-ACP synthase)
Swiss-Prot:ACPS_PELUB   RecName: Full=Holo-[acyl-carrier-protein] synthase;         Short=Holo-ACP synthase;         EC=2.7.8.7;AltName: Full=4'-phosphopantetheinyl transferase acpS;

Homologs  Archaea  0/68 : Bacteria  363/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
d.150.1
:128 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->128 3h88X PDBj 7e-19 41.0 %
:RPS:PDB   2->128 2bddA PDBj 4e-22 37.8 %
:RPS:SCOP  3->127 1f7lA  d.150.1.2 * 8e-25 39.5 %
:HMM:SCOP  2->127 1f7lA_ d.150.1.2 * 4.4e-25 40.9 %
:RPS:PFM   6->65 PF01648 * ACPS 2e-05 44.1 %
:HMM:PFM   6->70 PF01648 * ACPS 1.2e-15 33.8 65/70  
:BLT:SWISS 1->128 ACPS_PELUB 8e-60 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21861.1 GT:GENE acpS GT:PRODUCT Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1024245..1024631) GB:FROM 1024245 GB:TO 1024631 GB:DIRECTION - GB:GENE acpS GB:PRODUCT Holo-[acyl-carrier protein] synthase (Holo-ACP synthase) GB:PROTEIN_ID AAZ21861.1 GB:DB_XREF GI:71062858 GB:GENE:GENE acpS LENGTH 128 SQ:AASEQ MKILGIGVDIVENIRIHKSLKNVNFIKRVFSSSEILLAKKITNKKSFYSKRFAAKEAFSKAIGTGFRENLNFKDITVINDKLGKPSFVVTDKIKKIVKKRFKISSFNFFLSISDEKKYSVAYVILQKK GT:EXON 1|1-128:0| SW:ID ACPS_PELUB SW:DE RecName: Full=Holo-[acyl-carrier-protein] synthase; Short=Holo-ACP synthase; EC=2.7.8.7;AltName: Full=4'-phosphopantetheinyl transferase acpS; SW:GN Name=acpS; OrderedLocusNames=SAR11_1055; SW:KW Complete proteome; Cytoplasm; Fatty acid biosynthesis;Lipid synthesis; Magnesium; Metal-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->128|ACPS_PELUB|8e-60|100.0|128/128| GO:SWS:NREP 5 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006633|"GO:fatty acid biosynthetic process"|Fatty acid biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| SEG 92->103|kikkivkkrfki| BL:PDB:NREP 1 BL:PDB:REP 3->128|3h88X|7e-19|41.0|122/124| RP:PDB:NREP 1 RP:PDB:REP 2->128|2bddA|4e-22|37.8|119/127| RP:PFM:NREP 1 RP:PFM:REP 6->65|PF01648|2e-05|44.1|59/67|ACPS| HM:PFM:NREP 1 HM:PFM:REP 6->70|PF01648|1.2e-15|33.8|65/70|ACPS| GO:PFM:NREP 3 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF01648|IPR008278| GO:PFM GO:0008897|"GO:holo-[acyl-carrier-protein] synthase activity"|PF01648|IPR008278| GO:PFM GO:0009059|"GO:macromolecule biosynthetic process"|PF01648|IPR008278| RP:SCP:NREP 1 RP:SCP:REP 3->127|1f7lA|8e-25|39.5|114/118|d.150.1.2| HM:SCP:REP 2->127|1f7lA_|4.4e-25|40.9|115/118|d.150.1.2|1/1|4'-phosphopantetheinyl transferase| OP:NHOMO 371 OP:NHOMOORG 366 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------1-11---111------------------1-----------------1-11-1---111-----------------------------------------------------11-11111111111111111-1--111111111111-11111---111111111111111111111-----1-11------111---111111-1111--------------1111-111--111------------11111111111111111-11-1--------------11-------11---111-1111111---11-1-11111111111111-11-11-1-1-11111-11111111111111111111111111111111--11---11-121111-111111111111111-1--11-11------1----11------11-------1111-1-1----1----1----111-------------111111------1--------1111111--------11----------------------1-------1---11--1------------------1------1--11111111111221111111-21-1111111211111111-----1111111111111111111111111111111111111111111-1-------------1-----------------------------------------------------111111111111111---------------11---------------1---------------------------------------- -1---1-------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 128 STR:RPRED 100.0 SQ:SECSTR EEEEEEEEEEEEHHHHHHHHHcTTHHHHHccHHHHHHHHTccHHHHHHHHHHHHHHHHHHHTTccccccGGGGGEEEEEcTTccEEEEEcHHHHHHHHHHTcEEccEEEEEEEEEccEEEEEEEEEEE PSIPRED cEEEEEEEEEEEHHHHHHHHHcccHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEcccccEEEEEcHHHHHHHHHHHcccccEEEEEEEEcccEEEEEEEEEcc //