[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : acsA
DDBJ      :acsA         acetyl-CoA synthase
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  710/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:681 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->679 2p2bB PDBj 0.0 61.1 %
:RPS:PDB   55->136 3da5A PDBj 2e-05 10.0 %
:RPS:PDB   110->653 3cw9A PDBj 5e-80 19.5 %
:RPS:SCOP  59->668 1pg3A  e.23.1.1 * 4e-95 59.7 %
:HMM:SCOP  40->680 1pg4A_ e.23.1.1 * 8.6e-196 30.1 %
:RPS:PFM   59->135 PF11930 * DUF3448 7e-07 30.7 %
:RPS:PFM   144->579 PF00501 * AMP-binding 1e-53 36.5 %
:HMM:PFM   144->580 PF00501 * AMP-binding 3.5e-117 32.5 415/418  
:HMM:PFM   55->137 PF11930 * DUF3448 9.1e-29 40.0 80/82  
:BLT:SWISS 48->680 ACSA_PARL1 0.0 67.5 %
:PROS 294->305|PS00455|AMP_BINDING
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21136.1 GT:GENE acsA GT:PRODUCT acetyl-CoA synthase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 310070..312115 GB:FROM 310070 GB:TO 312115 GB:DIRECTION + GB:GENE acsA GB:PRODUCT acetyl-CoA synthase GB:PROTEIN_ID AAZ21136.1 GB:DB_XREF GI:71062133 GB:GENE:GENE acsA LENGTH 681 SQ:AASEQ MPKKKSISKAKKKTSKKTKAKKKVKPFIKKVLKKIEEKELIIKTKPEWVKSALVNKAKYQKKYSDAIKKNDDFWKNEGKRITWIKPYKKIKNIKYSKKEVKIKWYEDGTLNASANCIDRHLKDKKDKTAIIWVGDDPKDTKKISYKQLHNEVSKAANGLRKLGIKKGDRVTIYLTMIPELAVTMLACARIGAVHSIIFGGFSADSISGRVNDCESEYIITADEGVRGGKTIPLKQITDEALRSCPNVKKCIVVKRTGNKVSWVKGRDVWFDDLIKDMSTKCEPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYMVYASMTHQYIFNYKPKDVYWCTADIGWVTGHSYIVYGPLANGATTIMFEGIPTYPDSSRWWQIIDKYKVNIFYTAPTAIRALMREGDKPVKKTSRKSLKLLGTVGEPINPEAWMWYYKTVGNSKCPIVDTWWQTETGGILISPQTGAMNLKPGSASKPFYGIKPSIVDKDGKEIKGAGEGRLCISQSWPGQMRTVYGDHQRFIDTYFSQFDGKYFTGDGAKRDKDGYYWITGRVDDVIIVSGHNLGTAEIESAFVAHPKVAEAAVVGYPHDIKGNGLYCYVTLNVGEKSDLDLERDLKLWVRKQIGALATPDIIHFSPGLPKTRSGKIMRRILRKIAANEHDQLGDTTTLADPSVVQSLVDNRKNI GT:EXON 1|1-681:0| BL:SWS:NREP 1 BL:SWS:REP 48->680|ACSA_PARL1|0.0|67.5|633/647| PROS 294->305|PS00455|AMP_BINDING|PDOC00427| SEG 2->47|pkkksiskakkktskktkakkkvkpfikkvlkkieekeliiktkpe| SEG 84->105|ikpykkiknikyskkevkikwy| BL:PDB:NREP 1 BL:PDB:REP 53->679|2p2bB|0.0|61.1|622/639| RP:PDB:NREP 2 RP:PDB:REP 55->136|3da5A|2e-05|10.0|80/121| RP:PDB:REP 110->653|3cw9A|5e-80|19.5|502/503| RP:PFM:NREP 2 RP:PFM:REP 59->135|PF11930|7e-07|30.7|75/85|DUF3448| RP:PFM:REP 144->579|PF00501|1e-53|36.5|400/405|AMP-binding| HM:PFM:NREP 2 HM:PFM:REP 144->580|PF00501|3.5e-117|32.5|415/418|AMP-binding| HM:PFM:REP 55->137|PF11930|9.1e-29|40.0|80/82|DUF3448| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00501|IPR000873| GO:PFM GO:0008152|"GO:metabolic process"|PF00501|IPR000873| RP:SCP:NREP 1 RP:SCP:REP 59->668|1pg3A|4e-95|59.7|610/634|e.23.1.1| HM:SCP:REP 40->680|1pg4A_|8.6e-196|30.1|641/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 7571 OP:NHOMOORG 959 OP:PATTERN 43-2--7IHFHHHGGC2174753HC44522793261--333217576754332----1---554---2 1377L422334B19JaKEE-DU44PVEEEEEDUTYTQn*x4M6U3114255-93A978--C9C1EEUKEI62-1111--386G213212222-2--1--31412282323---------------32233323353BBBEF222C85253993--11111311211472E211111111111165688--1DAFBBBBBDAFACBDCCA58EEBJDCH9JDAA34222232K3133434333333333311231-1-11-1-----1111---113211---------1---------------------------------11---11111411-1-C-33------42-81-51A92262--B41111---622F99F1111154VPV647SIXOM46674465657-87C87J7B8HK-844867997B88BG776DBF4656BAI33333333A3212B95-----------------------------2BCSD-6HG8EEHIIJIA8887CBHMCCCC8EOAWUejW34HHA9CAAAOAIFRK3391121752222222222H885iLD7565466555-3542523354564M8B9111--11111-111-11-11122241145-684755645555546755556475588--12753------32934225555555554-454555555555555455433433BB35344555555445445413233331-322222222222---422231565435945111111-111-11127787768688A4GGHHFJCAACFHE788E21111112112346555557645544444443332222--2-222222-----1--1-------------------------------------11- 1111VU5-931-67BNNFCGECCGDIIEGDCACCB9GECFDFEDCCB8CFDDIKADC8AEDC52232232332223333332222222-DD6N88H343374BHGD1798QGL9F9GA4587D9SJ6P8c*J1MIQ9A8AGA9FA87876E65M8EC9H9FH9XDHCDAPQ88ID1347n64495IMOkESK34E9B8C ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 629 STR:RPRED 92.4 SQ:SECSTR ####################################################cccccEEEEcTTccTTTcHHHHHHcTTcEEEccEEcTTccEETTccccccccETccccccHHHHHHHHHHHcTTcEEEEETTTcGGGTEEEEHHHHHHHHHHHHHHHHHTTccTTcEEEEEccccHHHHHHHHHHHHHTcEEEEEcTTccHHHHHHHHHHTTccEEEEcccHHHHHHcHEEHHHHHHHHTTcccEEEEHHcccccccTTcEEHHHHEETTEEcccccccccccccTTcEEEEEEEcccccccEEEEEEGGGHHHHHHHHHTccccccTTcEEEEcccTTcHHHHHTTHHHHHHTTcEEEEcHcccccccHHHHHHHHHHHTccEEEEcHHHHHHHHHHHHHTcTTcccTTccEEEEccccccHHHHHHHHHHcccTccEEEEEEEETTTEEEEEEEccccccccEEcccTTccEEEEcTTccTTccccTTTccEEEEEEccTTcccccTTcHHHHHHHHHHEETTEEEEEEEEEEcTTccEEEEEEccccEEETTEEEcHHHHHHHHTTcTTEEEEEEEEEEETTTEEEEEEEEEEcTTccccccHHHHHHHHHHccccGGGcccEEEEcccccccTTccccHHHHHHHHcHHHTcEEEEEEEEEETTEEHHHHHHHHc DISOP:02AL 1-39| PSIPRED ccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHEEEccccccEEccccccccccccccccccccHHHHHHHHHHHHccccEEEEEEcccccccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHcccEEEEEEHHHccccccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHcccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHccccEEEcHHHHHHHHHHcccHHHHHcccccEEEEEEccccccHHHHHHHHHHcccccEEEEEccccHHHHHHEEccccccccccccEEccccccEEEEEEcccccccccccEEEEEEEccccccHHHHccccHHHHHHHHHHcccEEEEccEEEEccccEEEEEcccccEEEcccEEEcHHHHHHHHHHcccEEEEEEEcccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccccEEEEEccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcc //