[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : argF
DDBJ      :argF         Ornithine carbamoyltransferase
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  838/915 : Eukaryota  191/199 : Viruses  1/175   --->[See Alignment]
c.78.1
:309 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   43->309 1pvvA PDBj 1e-55 42.6 %
:RPS:PDB   1->309 3e2pA PDBj 7e-69 28.1 %
:RPS:SCOP  2->148 1a1sA1  c.78.1.1 * 1e-38 40.4 %
:RPS:SCOP  153->308 1a1sA2  c.78.1.1 * 1e-27 37.8 %
:HMM:SCOP  1->311 1tugA1 c.78.1.1 * 9.4e-86 35.1 %
:RPS:PFM   2->148 PF02729 * OTCace_N 8e-24 39.7 %
:RPS:PFM   157->301 PF00185 * OTCace 3e-15 32.9 %
:HMM:PFM   2->148 PF02729 * OTCace_N 6.6e-45 44.7 141/142  
:HMM:PFM   156->303 PF00185 * OTCace 3.9e-41 36.7 147/158  
:BLT:SWISS 1->308 OTC_NOVAD 4e-63 42.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21325.1 GT:GENE argF GT:PRODUCT Ornithine carbamoyltransferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 490384..491313 GB:FROM 490384 GB:TO 491313 GB:DIRECTION + GB:GENE argF GB:PRODUCT Ornithine carbamoyltransferase GB:PROTEIN_ID AAZ21325.1 GB:DB_XREF GI:71062322 GB:GENE:GENE argF LENGTH 309 SQ:AASEQ MKHFINLKDIPSADLKKIIIDAKNRKQKRKNYNTLEVDKDKPLKGKLLIQMFEKASLRTRLSFYLAIKQLGGGTITLRANELHLGKGGESLADTAKILSTYGDGFMLRTDSDKKIEEFSRYLKIPVINGLSPSSHPTQVLSDIFTVEEIKKKSISKLNICWIGDSNNVLNSLIAASVKFSFNLNIGCPKNYGPKKFVLDWVKKNKRKIHIFYDAKKAVKNADVIFSDKVISLNDKVNKNKKIKDFRNFQINSKLMSFAKKDTTFLHCLPRGEEVAADVFLGKNSEVWLQALNRVHVQKSILLYCFGKLR GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 1->308|OTC_NOVAD|4e-63|42.0|305/311| SEG 233->244|ndkvnknkkikd| BL:PDB:NREP 1 BL:PDB:REP 43->309|1pvvA|1e-55|42.6|265/313| RP:PDB:NREP 1 RP:PDB:REP 1->309|3e2pA|7e-69|28.1|299/306| RP:PFM:NREP 2 RP:PFM:REP 2->148|PF02729|8e-24|39.7|141/142|OTCace_N| RP:PFM:REP 157->301|PF00185|3e-15|32.9|143/157|OTCace| HM:PFM:NREP 2 HM:PFM:REP 2->148|PF02729|6.6e-45|44.7|141/142|OTCace_N| HM:PFM:REP 156->303|PF00185|3.9e-41|36.7|147/158|OTCace| GO:PFM:NREP 5 GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF02729|IPR006132| GO:PFM GO:0016743|"GO:carboxyl- or carbamoyltransferase activity"|PF02729|IPR006132| GO:PFM GO:0006520|"GO:cellular amino acid metabolic process"|PF00185|IPR006131| GO:PFM GO:0016597|"GO:amino acid binding"|PF00185|IPR006131| GO:PFM GO:0016743|"GO:carboxyl- or carbamoyltransferase activity"|PF00185|IPR006131| RP:SCP:NREP 2 RP:SCP:REP 2->148|1a1sA1|1e-38|40.4|141/150|c.78.1.1| RP:SCP:REP 153->308|1a1sA2|1e-27|37.8|156/163|c.78.1.1| HM:SCP:REP 1->311|1tugA1|9.4e-86|35.1|299/0|c.78.1.1|1/1|Aspartate/ornithine carbamoyltransferase| OP:NHOMO 2126 OP:NHOMOORG 1097 OP:PATTERN 22421212222222222222222222222222222222222221222222222222222222224-22 1421121122212221111-1211121111113111111112221212122222222211324111221122222222127421122222122211-1-212122222-----------------222121222222222222221111111111222221122111111111122211112222222221222111112212112221223322221221121212221122133333333433334443222-2----1---1111--2-211-3222221111121111111111111111111111111111111111122123222222222222222222212322323222222221232222212222211222113222222222222222222222223-222222222232222223223233121113212222222222222222112212222122222-----------------111121122223232433333333333344444434335222222222223222222322222222332222222222222-22222323222212222222222221212222222211111112111111122222223332222322222222225222222222221-3322321122234222323223332322-22322232322222222232222222233333233333333333222222221222222222222111311111111122323111111111-11--122222222222233333333333334233211111111222242222222422112222222222221122222222111111111---------12-1------121-----1222211111221 11--112-31111122221222221222222222222222-221222222222222222222223222222122222-2222222222-21222222222221364-23151332431222121432224A2-3221121212211211122122121212312211111611312222H2222241232221222221 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- STR:NPRED 309 STR:RPRED 100.0 SQ:SECSTR ccccccGGGccHHHHHHHHHHHHHHHHHHHHcccccTccccTTTTcEEEEEEccccHHHHHHHHHHHHHTTcEEEEEcTTcHHHHTTTccHHHHHHHHHHHccEEEEEcccccHHHHHHHHccccEEEcccccccHHHHHHHHHHHHHcHHccccccEEEEEccTcHHHHHHHHHHTTcTcEEEEEcccTTcccHHHHHHHHHTTccEEEEccGGGccTTccEEEEcccccGGGcccHHHHHHHHHHHcccHHHHHHTTcccEEEccccccccccGGGTTcTTccHHHHHHHHHHHHHHHHHHHHHHTc PSIPRED ccccccHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEccccEEEEcccccHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEccccccccHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHccccEEEEccEEEccccccHHHHHHHHHcccccHHHHHHcccccEEEccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc //