[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : argG
DDBJ      :argG         Argininosuccinate synthase (Citrulline--aspartate ligase)
Swiss-Prot:ASSY_PELUB   RecName: Full=Argininosuccinate synthase;         EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase;

Homologs  Archaea  56/68 : Bacteria  756/915 : Eukaryota  175/199 : Viruses  0/175   --->[See Alignment]
c.26.2d.210.1
:395 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->386 1korB PDBj e-109 51.9 %
:RPS:PDB   5->357 2deuA PDBj 1e-44 13.3 %
:RPS:SCOP  6->169 1j1zA1  c.26.2.1 * 4e-72 58.5 %
:RPS:SCOP  178->394 1k92A2  d.210.1.1 * 4e-46 25.3 %
:HMM:SCOP  1->174 1k92A1 c.26.2.1 * 1.4e-48 34.1 %
:HMM:SCOP  177->394 1korA2 d.210.1.1 * 2.8e-75 45.9 %
:RPS:PFM   8->394 PF00764 * Arginosuc_synth e-125 53.2 %
:HMM:PFM   8->390 PF00764 * Arginosuc_synth 1.1e-145 45.0 380/390  
:BLT:SWISS 1->395 ASSY_PELUB 0.0 100.0 %
:PROS 10->18|PS00564|ARGININOSUCCIN_SYN_1
:PROS 118->129|PS00565|ARGININOSUCCIN_SYN_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21115.1 GT:GENE argG GT:PRODUCT Argininosuccinate synthase (Citrulline--aspartate ligase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 293329..294516 GB:FROM 293329 GB:TO 294516 GB:DIRECTION + GB:GENE argG GB:PRODUCT Argininosuccinate synthase (Citrulline--aspartate ligase) GB:PROTEIN_ID AAZ21115.1 GB:DB_XREF GI:71062112 GB:GENE:GENE argG LENGTH 395 SQ:AASEQ MKSKKKIVLAYSGGLDTSIILKWLQENYDAEVICYTADVGQEIDRKKIIKNAKRLGVKNIIIEDLKDTFVKDYVFPMIRGHAIYEGVYLLGTSIARPLIAKRQIAAAKKFGAYAVSHGSTGKGNDQVRFELGYHYFGPKVKIIAPWRIWKLNSRTDLIKYAKKNNIPIPTDKKGAPPFSIDDNLYHTSTEGKVLENPKNSAPEFLFQRTVSPEKAPNKASFVTIGFKNGDPITVNGKKLSPGNLLEKLNNVAGKNGIGRVDLVENRFIGIKSRGVYETPGGTLLMSAHRAIESITLDKETMHKKDEIMPKYAELIYNGYWYSKARFKLQKIVDLKKNKVNGSVKLKLYKGNITIMSRQTKSNAYSMKKVSFEENKTFNKSNVERFINFHKQKLRS GT:EXON 1|1-395:0| SW:ID ASSY_PELUB SW:DE RecName: Full=Argininosuccinate synthase; EC=6.3.4.5;AltName: Full=Citrulline--aspartate ligase; SW:GN Name=argG; OrderedLocusNames=SAR11_0294; SW:KW Amino-acid biosynthesis; Arginine biosynthesis; ATP-binding;Complete proteome; Cytoplasm; Ligase; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->395|ASSY_PELUB|0.0|100.0|395/395| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0006526|"GO:arginine biosynthetic process"|Arginine biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 10->18|PS00564|ARGININOSUCCIN_SYN_1|PDOC00488| PROS 118->129|PS00565|ARGININOSUCCIN_SYN_2|PDOC00488| BL:PDB:NREP 1 BL:PDB:REP 6->386|1korB|e-109|51.9|370/386| RP:PDB:NREP 1 RP:PDB:REP 5->357|2deuA|1e-44|13.3|324/364| RP:PFM:NREP 1 RP:PFM:REP 8->394|PF00764|e-125|53.2|385/390|Arginosuc_synth| HM:PFM:NREP 1 HM:PFM:REP 8->390|PF00764|1.1e-145|45.0|380/390|Arginosuc_synth| GO:PFM:NREP 3 GO:PFM GO:0004055|"GO:argininosuccinate synthase activity"|PF00764|IPR001518| GO:PFM GO:0005524|"GO:ATP binding"|PF00764|IPR001518| GO:PFM GO:0006526|"GO:arginine biosynthetic process"|PF00764|IPR001518| RP:SCP:NREP 2 RP:SCP:REP 6->169|1j1zA1|4e-72|58.5|164/165|c.26.2.1| RP:SCP:REP 178->394|1k92A2|4e-46|25.3|217/256|d.210.1.1| HM:SCP:REP 1->174|1k92A1|1.4e-48|34.1|173/188|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| HM:SCP:REP 177->394|1korA2|2.8e-75|45.9|218/225|d.210.1.1|1/1|Argininosuccinate synthetase, C-terminal domain| OP:NHOMO 1102 OP:NHOMOORG 987 OP:PATTERN ---1-11111111111-1111111111111111111111111111111111111-1-----1111-11 1111111111111111111-11111111111111111111111111111111111111--121111121211111111--11111111111111---111-1-1111111---------------11111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111----11-1---111111-1-111111111----111111111--1-1-------------111111111111-1111111111111111111-1111-1111111111-11111111--1111111111--1111111111111111111111111-1111111111112112121222111111111111111111111111111111111---11111---------------------11111111111111111111111111222221111111111111111111111111111111111111111111111-111111111111111111111111111112111111111111-1-------1111111111111111111111111111111111111-1-111111111111111111111111111-111111111111111111111111221111111111111111111111111--111111111111---1-----111111111111111111111111111-11111111111111111111111111--------111111111111122111111111111111111111111-------------------------------------11--11111111 ------1-11--11111111111121111111111111111111112121222221111111-11111-1111111111111111111-11111121111121112-11-21212111111111211B1AS2-552-1-121112-1-1-11-2131-2132131111112--11111181111111221121111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 394 STR:RPRED 99.7 SQ:SECSTR HTTccEEEEEccccHHHHHHHHHHHHHHccEEEEEEEccccccccHHHHHHHHHHTccEEEEEcTHHHHHHHTHHHHHHHHHTTccccHHHHHcccccTTHHHHHHHTTcccccEEccEEEEcccTTcccGGGGTTccHHHHHTEEccGGGccHHHHHHHHHHHTcTTcccHHHcHcccccccccccccHHHHHTTTccccccEEEcccccEEEEccccTTccTTccTTccccccEcTTcTTTcEEEcccccccccEEEEETTTTEEEEEcccTTcGGGEEEEEEEccccccEEEEEEcccTTcccEEEEEEEcccccEEEEHHHHHEEEEEEccHHTccTTccccEEccccEEEccccHHHHHHHHHHHHHccccEEcccccccccTTccccH# DISOP:02AL 1-3, 394-395| PSIPRED cccccEEEEEEEcccHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHcccEEccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHEEccccEEEEEEccccccccHHHHHHHHHcccccccccccccccccccHHHcccccccccccccccccHHHHHHcccHHHccccccEEEEEEEccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHEEEEEEEEEEEccEEEEEEEccccccccHHcccccccccccHHHHHHHHHHHcccccc //