[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : aroB
DDBJ      :aroB         3-dehydroquinate synthase
Swiss-Prot:AROB_PELUB   RecName: Full=3-dehydroquinate synthase;         EC=4.2.3.4;

Homologs  Archaea  28/68 : Bacteria  806/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
e.22.1
:368 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->348 1xaiA PDBj 5e-48 34.4 %
:RPS:PDB   6->345 2d2xB PDBj 7e-55 26.9 %
:RPS:SCOP  14->348 1dqsA  e.22.1.1 * 4e-62 33.3 %
:HMM:SCOP  4->364 1dqsA_ e.22.1.1 * 5.2e-92 34.7 %
:RPS:PFM   20->330 PF01761 * DHQ_synthase 2e-57 38.6 %
:HMM:PFM   19->331 PF01761 * DHQ_synthase 4.5e-95 38.6 308/313  
:BLT:SWISS 1->368 AROB_PELUB 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21274.1 GT:GENE aroB GT:PRODUCT 3-dehydroquinate synthase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(448146..449252) GB:FROM 448146 GB:TO 449252 GB:DIRECTION - GB:GENE aroB GB:PRODUCT 3-dehydroquinate synthase GB:PROTEIN_ID AAZ21274.1 GB:DB_XREF GI:71062271 GB:GENE:GENE aroB LENGTH 368 SQ:AASEQ MGLIKLKVNTNSQQYSIIIGNNILKKVNKFLKENSIDFNQCLLVIDKNIPKNLVKDTLKSLPKGSVSIHYFNASEKNKNLKSVNEITSILLKKSFNRNDCLISIGGGITGDVSGFAASTFKRGLKFVNIPTTLLSQVDSSIGGKTGVNTKYGKNLIGSFYQPSLVISDTNFLNSLPKREVVCGYGEILKHSLINGKKFFYFLNKNGKKIIQLKSPFIQTAIHQSCLIKKKVVEADEKELGIRKILNFGHTFAHAFEATLRYSAKLNHGEAVILGVKTAARFSLLNKILNKKEFELIDGHLNDLNLPRDINKFFSIKNLNTIISFMRKDKKNNTKKISLVLLKRIGSPVYKLQFNEKTINLFLKKELTK GT:EXON 1|1-368:0| SW:ID AROB_PELUB SW:DE RecName: Full=3-dehydroquinate synthase; EC=4.2.3.4; SW:GN Name=aroB; OrderedLocusNames=SAR11_0452; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Cytoplasm; Lyase; NAD. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->368|AROB_PELUB|0.0|100.0|368/368| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 4->348|1xaiA|5e-48|34.4|331/352| RP:PDB:NREP 1 RP:PDB:REP 6->345|2d2xB|7e-55|26.9|323/352| RP:PFM:NREP 1 RP:PFM:REP 20->330|PF01761|2e-57|38.6|306/312|DHQ_synthase| HM:PFM:NREP 1 HM:PFM:REP 19->331|PF01761|4.5e-95|38.6|308/313|DHQ_synthase| GO:PFM:NREP 2 GO:PFM GO:0003856|"GO:3-dehydroquinate synthase activity"|PF01761|IPR002658| GO:PFM GO:0009073|"GO:aromatic amino acid family biosynthetic process"|PF01761|IPR002658| RP:SCP:NREP 1 RP:SCP:REP 14->348|1dqsA|4e-62|33.3|333/381|e.22.1.1| HM:SCP:REP 4->364|1dqsA_|5.2e-92|34.7|357/388|e.22.1.1|1/1|Dehydroquinate synthase-like| OP:NHOMO 1074 OP:NHOMOORG 957 OP:PATTERN 11-1--1111111111-111111-------------------------------111111-111---- 1111111111111111111-111131111111111112111322111111111111111132114121111111111111111-----11111111-111111122121211111111111111121121111111111112222113311111111111111111122421111111211111211111-111111111111111111111111111111111111111111111111111111111111111----------11----1--11-1111111111111111111111111111111111111111111111-11111222222312111111111111-11111111111111111111-11112111111111111112112211111111111111-11111111111-1111111111111111111111111111111111111111211-----------------------------11111111111111111111111111111111111111121111111111112111112111211111111111111112-2----11----22221111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111211113211111111111111111111111111111111111111111111111111111221111--------1-1---------------------------1--1-111112 ------2-----1113222211211111111111111111111111121122212221111111-111-21211111-111-111111-23121111111132222-13--12------------------------------------------11-1----1---------2-211161111211312212211114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 365 STR:RPRED 99.2 SQ:SECSTR ###cEEEEEETTEEEEEEEETTcGGGGGGTccTHHTTccEEEEEEETTccHHHHHHHHHHHTTccEEEEEEcccTTTccHHHHHHHHHHHHHTTccTTEEEEEEEcHHHHHHHHHHHHHGGGccEEEEEEccHHHHHTGGGccEEEEEETTEEEEEEEEccccEEEEEHHHHHTccHHHHHHHHHHHHHHHHHcccccccccGGGccccccccHHHHHHHHHHHHHHHHHHHTTcTTcccGGGGGGTTHHHHHHHHHHTTTTccccHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHTTTTTcccccTTccccHHHHHHHHcccEEccTcEEEEEcEEETTEEcccTTcccEEEEHHHHHHHHH DISOP:02AL 368-369| PSIPRED ccEEEEEEEcccccEEEEEcccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHccccEEEEcccHHHcccccccccEEEEcccccccEEccccccEEEEcHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHcccccHHHHHHHHHHHHHccccEEEEEEEcccccEEEEccccHHHHHHHHHHHHcc //