[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : aroC
DDBJ      :aroC         chorismate synthase
Swiss-Prot:AROC_PELUB   RecName: Full=Chorismate synthase;         EC=4.2.3.5;AltName: Full=5-enolpyruvylshikimate-3-phosphate phospholyase;

Homologs  Archaea  61/68 : Bacteria  816/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
d.258.1
:360 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->342 1um0A PDBj 3e-73 46.2 %
:RPS:PDB   1->127 3eatX PDBj 6e-35 11.1 %
:RPS:SCOP  4->355 1um0A  d.258.1.1 * e-107 44.3 %
:HMM:SCOP  3->359 1sq1A_ d.258.1.1 * 4.4e-141 54.4 %
:RPS:PFM   10->354 PF01264 * Chorismate_synt e-103 55.6 %
:HMM:PFM   10->353 PF01264 * Chorismate_synt 1.1e-148 57.5 341/346  
:BLT:SWISS 1->360 AROC_PELUB 0.0 100.0 %
:PROS 16->31|PS00787|CHORISMATE_SYNTHASE_1
:PROS 124->140|PS00788|CHORISMATE_SYNTHASE_2
:PROS 327->343|PS00789|CHORISMATE_SYNTHASE_3
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21433.1 GT:GENE aroC GT:PRODUCT chorismate synthase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(598475..599557) GB:FROM 598475 GB:TO 599557 GB:DIRECTION - GB:GENE aroC GB:PRODUCT chorismate synthase GB:PROTEIN_ID AAZ21433.1 GB:DB_XREF GI:71062430 GB:GENE:GENE aroC LENGTH 360 SQ:AASEQ MSFNTFGKQFRFTTWGESHGPALGCVVDGCPPNINLKEQDIQVELDKRKPGQSKFTTQRKEDDKVQILSGVFEGKTTGTPISLIIYNQDMRSKDYGDIKDKFRPGHADFTYFKKYGIRDYRGGGRSSARETAARVAAGAIAKKVLENKLGKKFKVVGAVTQLGILGCDTRKWNDLTINKNPFFCPDKNMLKLWEKYLLDIRKSGSSCGAVIEVRARGIPVGLGAPIYSKLDMDIASAMMSINAVKGVNIGSGMNSAQLSGEQNSDEISQKGKKLKFDSNNAGGILGGISTGQEIVVSFAVKPTSSILTTRKTINKFGKNTTISVKGRHDPCVGIRAVPVGEAMMNCVLLDHYLMNKAQCS GT:EXON 1|1-360:0| SW:ID AROC_PELUB SW:DE RecName: Full=Chorismate synthase; EC=4.2.3.5;AltName: Full=5-enolpyruvylshikimate-3-phosphate phospholyase; SW:GN Name=aroC; OrderedLocusNames=SAR11_0612; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->360|AROC_PELUB|0.0|100.0|360/360| GO:SWS:NREP 3 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 16->31|PS00787|CHORISMATE_SYNTHASE_1|PDOC00628| PROS 124->140|PS00788|CHORISMATE_SYNTHASE_2|PDOC00628| PROS 327->343|PS00789|CHORISMATE_SYNTHASE_3|PDOC00628| SEG 128->141|aretaarvaagaia| BL:PDB:NREP 1 BL:PDB:REP 4->342|1um0A|3e-73|46.2|327/365| RP:PDB:NREP 1 RP:PDB:REP 1->127|3eatX|6e-35|11.1|126/278| RP:PFM:NREP 1 RP:PFM:REP 10->354|PF01264|e-103|55.6|342/345|Chorismate_synt| HM:PFM:NREP 1 HM:PFM:REP 10->353|PF01264|1.1e-148|57.5|341/346|Chorismate_synt| GO:PFM:NREP 2 GO:PFM GO:0004107|"GO:chorismate synthase activity"|PF01264|IPR000453| GO:PFM GO:0009073|"GO:aromatic amino acid family biosynthetic process"|PF01264|IPR000453| RP:SCP:NREP 1 RP:SCP:REP 4->355|1um0A|e-107|44.3|343/365|d.258.1.1| HM:SCP:REP 3->359|1sq1A_|4.4e-141|54.4|349/360|d.258.1.1|1/1|Chorismate synthase, AroC| OP:NHOMO 1048 OP:NHOMOORG 999 OP:PATTERN 11-1--1111111111-111111111111111111111111111111111111111-111-1111-11 1111-11111111111111-11111111111111111111-1111111111111111111111111111111111111111211111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111222222221222222111111222111111111111111111111111111111111111------1---11-------11-1111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11111111111111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111-21211111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111--------1-1---------------------------1--1-111111 11----1-1---11111111111121-11111111111111111111111111111111111111111111111111-1111-11111-12111111111111111-13------------------------------------------------------1---------1-1121G1111211121121131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 358 STR:RPRED 99.4 SQ:SECSTR cccccccccEEEEEcccTTcccccEEEEEccTTccGGGcHHHHHHHHHcEEEEccccccccHHHHHHHHHHHTccccccTTcccEEEEEcTTcccTTTccccEEEEcTTTTccEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcHTcHHTTEEEEEEEEEETTEEcccccHHHcTTccccHHHHHHHHHHHHHHHHTTccccEEEEEEEEEcccccccTTTccHHHHHHHHHHTcTTEEEEEETTGGGGGGccHHHHcccEETTETcccEcccTTTTEETTEEccccEEEEEEEcccccccccEEEEcTTccEEEEcccccccccTHHHHHHHHHHHHHHHHHHHHHHHHHH## DISOP:02AL 1-3, 52-58| PSIPRED cccccccccEEEEEcccccccEEEEEEEccccccEEcHHHHHHHHHHccccccccccccccccEEEEEEEEEccEEccccEEEEEEEcccccccHHHHHHcccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEcccccccHHHHHccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccccccHHHHHHHHHHccccEEEEEEEccHHHHccccccccccEEEccccEEEEEcccccEEcccccccEEEEEEEEEccccccccccEEEccccEEEEEEEcccccEEcccHHHHHHHHHHHHHHHHHHHHHcccc //