[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : aroE
DDBJ      :aroE         shikimate 5-dehydrogenase
Swiss-Prot:AROE_PELUB   RecName: Full=Shikimate dehydrogenase;         EC=1.1.1.25;

Homologs  Archaea  50/68 : Bacteria  725/915 : Eukaryota  99/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:265 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->256 2eggA PDBj 9e-39 36.1 %
:RPS:PDB   1->255 2cy0B PDBj 2e-56 28.4 %
:RPS:SCOP  3->101 1nytA2  c.58.1.5 * 1e-29 34.3 %
:RPS:SCOP  102->256 1npyA1  c.2.1.7 * 1e-34 27.5 %
:HMM:SCOP  1->101 1nvtA2 c.58.1.5 * 8.3e-33 41.6 %
:HMM:SCOP  102->267 1npyA1 c.2.1.7 * 4.3e-32 29.3 %
:RPS:PFM   7->89 PF08501 * Shikimate_dh_N 6e-14 39.8 %
:RPS:PFM   116->220 PF01488 * Shikimate_DH 3e-08 31.3 %
:HMM:PFM   7->89 PF08501 * Shikimate_dh_N 1.3e-29 47.0 83/83  
:HMM:PFM   113->210 PF01488 * Shikimate_DH 4.5e-15 30.1 93/135  
:BLT:SWISS 1->265 AROE_PELUB e-152 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21164.1 GT:GENE aroE GT:PRODUCT shikimate 5-dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(333254..334051) GB:FROM 333254 GB:TO 334051 GB:DIRECTION - GB:GENE aroE GB:PRODUCT shikimate 5-dehydrogenase GB:PROTEIN_ID AAZ21164.1 GB:DB_XREF GI:71062161 GB:GENE:GENE aroE LENGTH 265 SQ:AASEQ MKKTFLVIGNPIKHSLSPKLHNYWIKKYKINATYEKNLLDHSEIEDLIFNIRKEKIHGLNITVPFKKMIIPFLDELSEEAEISQSVNTIYKRDNKIIGDNTDIEGFKLSLEKTEQNVKNKKALILGAGGVVSSIIIALKKIQIEKIYLSNRTELKAIELKKHFPEIEIIKWGETIDFDMIINATSIGLKEEDEININYQKISKDKFFYDVIYNPPETNFLKNAKKYGGITKNGKMMFIYQAQKAFFIWHKIVPEVDSETINLLDV GT:EXON 1|1-265:0| SW:ID AROE_PELUB SW:DE RecName: Full=Shikimate dehydrogenase; EC=1.1.1.25; SW:GN Name=aroE; OrderedLocusNames=SAR11_0341; SW:KW Amino-acid biosynthesis; Aromatic amino acid biosynthesis;Complete proteome; NADP; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->265|AROE_PELUB|e-152|100.0|265/265| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009073|"GO:aromatic amino acid family biosynthetic process"|Aromatic amino acid biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 1->256|2eggA|9e-39|36.1|255/278| RP:PDB:NREP 1 RP:PDB:REP 1->255|2cy0B|2e-56|28.4|250/263| RP:PFM:NREP 2 RP:PFM:REP 7->89|PF08501|6e-14|39.8|83/83|Shikimate_dh_N| RP:PFM:REP 116->220|PF01488|3e-08|31.3|99/115|Shikimate_DH| HM:PFM:NREP 2 HM:PFM:REP 7->89|PF08501|1.3e-29|47.0|83/83|Shikimate_dh_N| HM:PFM:REP 113->210|PF01488|4.5e-15|30.1|93/135|Shikimate_DH| GO:PFM:NREP 3 GO:PFM GO:0004764|"GO:shikimate 5-dehydrogenase activity"|PF01488|IPR006151| GO:PFM GO:0005737|"GO:cytoplasm"|PF01488|IPR006151| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01488|IPR006151| RP:SCP:NREP 2 RP:SCP:REP 3->101|1nytA2|1e-29|34.3|99/101|c.58.1.5| RP:SCP:REP 102->256|1npyA1|1e-34|27.5|153/167|c.2.1.7| HM:SCP:REP 1->101|1nvtA2|8.3e-33|41.6|101/110|c.58.1.5|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 102->267|1npyA1|4.3e-32|29.3|164/0|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1182 OP:NHOMOORG 874 OP:PATTERN ---1--1111111111-1--11111------111111111111111-111111111-111-1111-11 112-112122211-1---------1------11----12211-3--1-1--1211--1---------1-------1--11-111111112111111-11111111111111------1111111111111111111-11-11111111111111111111111111111111111111111111121111-113111111111111111111121111111111133333311111111111111111111111--1221--1-44--2-11-11-1111111111111111111111112222222222222111111111111111111111111212331111111-11121111111111111111-21-11111111111315311111111133333333331-11-11311311-1332313323221211111211111121111111111121111-----------------------------11211------211112-111122221111-11121111111111-----1----11-1-111111111111111-1-1211111111111-11-111121------111111111111111111111111111111111111111211111111111111111111--111111111111212122222222222-2222322232222222223443111113131333333323213112222221-222222212222111111111111111123111121122222112111111111141112123331544412322111111111111111111111--11------------1111111111--------1-1---------------------------1--1-1111-1 ------1-----11123321453444411111111111-1111111122263541231211-112111-21111211-111-111111-12231111111231111-1-----------------------------------------------------------------------------1-151-1--1111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 99.6 SQ:SECSTR cEEEEEEEEcccTTccHHHHHHHHHHHTTccEEEEEEEccGGGHHHHHHHHHHHHccEEEEcTTcccTTGGGccEEcHHHHHHTcccEEEEETTEEEEEccHHHHHHHHHHHHccccccTcEEEEcccHHHHHHHHHHHHHTTccEEEEcccHHHHHHHHHHTTcEEccGGGGGGGccEEEEcccTTTTcTTcccccGGGcccccEEEEccccccccHHHHHHHHTTcEEEccHHHHHHHHHHHHHHHHcccccHHHHHHHHHH# PSIPRED ccEEEEEEccHHHHHccHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHcccccHHHHHcccccEEEEEccEEEEEcccHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccEEccHHHHccccEEEEcccccccccccccccHHHcccccEEEEEcccccccHHHHHHHHccccEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHcc //