[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : aroK
DDBJ      :aroK         shikimate kinase
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  513/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:170 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->146 2pt5B PDBj 6e-18 34.6 %
:RPS:PDB   5->165 2cdnA PDBj 3e-07 13.8 %
:RPS:SCOP  5->165 1knqA  c.37.1.17 * 2e-12 15.3 %
:HMM:SCOP  5->168 2axpA1 c.37.1.1 * 3.3e-27 30.4 %
:RPS:PFM   13->145 PF01202 * SKI 2e-18 33.8 %
:HMM:PFM   13->166 PF01202 * SKI 7.8e-43 31.8 154/158  
:BLT:SWISS 7->166 AROK_BARQU 3e-26 37.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21275.1 GT:GENE aroK GT:PRODUCT shikimate kinase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(449239..449751) GB:FROM 449239 GB:TO 449751 GB:DIRECTION - GB:GENE aroK GB:PRODUCT shikimate kinase GB:PROTEIN_ID AAZ21275.1 GB:DB_XREF GI:71062272 GB:GENE:GENE aroK LENGTH 170 SQ:AASEQ MNSNKNLVFLGMMGSGKSSIGAMVSKQLNIPFIDIDNLIEEHAGMTISEIFKVNGEAYFRNLEEKITIKSLKHKKVVVSLGGGSFINDKIRKDILKNHFSFWLDWDDLVLIKRIKGSKKRPLASNSTDLEIKAIINKRKKVYSKANFKINCNKLTKSEIVKTIIKTYGLN GT:EXON 1|1-170:0| BL:SWS:NREP 1 BL:SWS:REP 7->166|AROK_BARQU|3e-26|37.5|160/210| SEG 69->84|kslkhkkvvvslgggs| BL:PDB:NREP 1 BL:PDB:REP 15->146|2pt5B|6e-18|34.6|130/165| RP:PDB:NREP 1 RP:PDB:REP 5->165|2cdnA|3e-07|13.8|160/186| RP:PFM:NREP 1 RP:PFM:REP 13->145|PF01202|2e-18|33.8|133/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 13->166|PF01202|7.8e-43|31.8|154/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 5->165|1knqA|2e-12|15.3|157/171|c.37.1.17| HM:SCP:REP 5->168|2axpA1|3.3e-27|30.4|161/0|c.37.1.1|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 558 OP:NHOMOORG 533 OP:PATTERN -------------------------------------------1--2--111---------------- -1--1--1--1---1--11-1111-111111-1-----111---1------------------1-------1-----------111111111--------1111---1-----------------11111-11111--------1-1111111111111111111-111111111111111111111111---111111---1--1---11111111111111--11111111111111111111111111111--------------------1--------11111111111111111--------------11---111-111111111111111--11----11--1-211-111211111-1111-11-11111111111111241112122111111111111-11211111131-1111111111111111111111111121111111111111111-----------------------------11-111-------11-111111-112111111112111211--1--1---1121-11--1-1--111111111-11--1----------------1111-----------111-1111-11111111111-1--1111-11--1--1-------1-----------1------11111111--1111111111111-111111111111111111111111--1-111111111111111111111111111111111111111-1-----11111-1--111111111111--1----------1---1--------------1--------1----1111111111--11111---111111----------------------------------------------1----1--1-1 ---------------------------------------------------------------------------------------1---------------------------------------------------------------------------1-----------1-1--1--111312-4-11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 98.8 SQ:SECSTR ccEEcEEEEEccTTccHHHHHHHHHHHHTccEEEHHHHHHHHHHTTcHHHHHHHHHHHHTccccHHHHHHHHHHHTTcGGGTTcEEEEcccccHHcccEEEEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHTTTHHHHTTTTEEEEEcccccHHHHHHHHHHHHH## DISOP:02AL 1-3| PSIPRED ccccccEEEEccccccHHHHHHHHHHHccccEEEcHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHcccEEEEEccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHccc //