[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : atpB
DDBJ      :atpB         H+-transporting two-sector ATPase (subunit A)
Swiss-Prot:ATP6_PELUB   RecName: Full=ATP synthase subunit a;AltName: Full=F-ATPase subunit 6;AltName: Full=ATP synthase F0 sector subunit a;

Homologs  Archaea  2/68 : Bacteria  513/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
f.18.1
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   81->237 1c17M PDBj 3e-10 31.2 %
:RPS:SCOP  81->237 1c17M  f.18.1.1 * 9e-27 25.7 %
:HMM:SCOP  79->237 1c17M_ f.18.1.1 * 1.8e-44 43.1 %
:RPS:PFM   31->237 PF00119 * ATP-synt_A 7e-29 39.3 %
:HMM:PFM   26->238 PF00119 * ATP-synt_A 3.8e-63 39.6 212/215  
:BLT:SWISS 1->244 ATP6_PELUB e-126 100.0 %
:PROS 172->181|PS00449|ATPASE_A
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20940.1 GT:GENE atpB GT:PRODUCT H+-transporting two-sector ATPase (subunit A) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 127369..128103 GB:FROM 127369 GB:TO 128103 GB:DIRECTION + GB:GENE atpB GB:PRODUCT H+-transporting two-sector ATPase (subunit A) GB:NOTE Old name Fo ATP Synthase Subunit A; old EC 3.6.1.34 GB:PROTEIN_ID AAZ20940.1 GB:DB_XREF GI:71061937 GB:GENE:GENE atpB LENGTH 244 SQ:AASEQ MATNPMNQFEVYRIGPEIKLGAIDISFTNASLFMVISSLAILLIFNLGSKKNSLLPSKMQLLSELSYTFVSKMISDTAGSKAKPYFAFIFSIFMFVLFCNMFGMIPYAFTVTSHIIVTFILASFIFVGVTIIGFMKHGLGYLKLFVPSGVPAVLLPLIVVIEIISYLSRPVSLSVRLFANMMAGHTMMKVFGGFVISLGIVGGWLPLSFSVALTGLEILVAFLQAYVFAILTCIYLNDALNLHH GT:EXON 1|1-244:0| SW:ID ATP6_PELUB SW:DE RecName: Full=ATP synthase subunit a;AltName: Full=F-ATPase subunit 6;AltName: Full=ATP synthase F0 sector subunit a; SW:GN Name=atpB; OrderedLocusNames=SAR11_0116; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(0);Complete proteome; Hydrogen ion transport; Ion transport; Membrane;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->244|ATP6_PELUB|e-126|100.0|244/244| GO:SWS:NREP 9 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 172->181|PS00449|ATPASE_A|PDOC00420| TM:NTM 6 TM:REGION 24->46| TM:REGION 85->107| TM:REGION 114->136| TM:REGION 143->165| TM:REGION 189->211| TM:REGION 218->240| SEG 150->164|vpavllplivvieii| BL:PDB:NREP 1 BL:PDB:REP 81->237|1c17M|3e-10|31.2|138/142| RP:PFM:NREP 1 RP:PFM:REP 31->237|PF00119|7e-29|39.3|206/215|ATP-synt_A| HM:PFM:NREP 1 HM:PFM:REP 26->238|PF00119|3.8e-63|39.6|212/215|ATP-synt_A| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00119|IPR000568| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00119|IPR000568| GO:PFM GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|PF00119|IPR000568| RP:SCP:NREP 1 RP:SCP:REP 81->237|1c17M|9e-27|25.7|140/142|f.18.1.1| HM:SCP:REP 79->237|1c17M_|1.8e-44|43.1|153/171|f.18.1.1|1/1|F1F0 ATP synthase subunit A| OP:NHOMO 612 OP:NHOMOORG 572 OP:PATTERN --------------------------------------------------11---------------- 1111111111111111111-1111111111111---1111111111111--111111111111111211111111111-1111112111111-1--1--111111--111--------------1221-1112112---------111---------------1--1---------------------111--------------------11------------1111-1-1--------------------1----------11----1-11--------1111--------------11111111111111----------1-1-----------1-------------21-111111-1111------1111111111111211121111111111111111112-111111111111111111111111111112112122111111111111112111111111111111111111111111111111111111-----------11-11--111111----2---------------1-1--------1---------121---11121121112---1111111122111-1-211--1-11111111111111111-1111111-1--11-21----121---11-111111----1-11-11111111111111111111-11111111111111111111111111111111111111111111-111111111-----------1-1-11111------1-2---1---------1-1111111---1--------------1---11111111111112111112121111-----1111111--1-111111----------------------------------------------1-1 --------------1------2-----111-11111-------1-1--------221-----1-111---1-----1----------2-----1---11------2------11111-----1-21-1-12--11-----1--11--------1--------11------1-121111------1--13-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 56.6 SQ:SECSTR ################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#############HccccTTHHHHHHHHHHHHHHHHHHHH######HHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc####### DISOP:02AL 240-244| PSIPRED cccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //