[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : atpC
DDBJ      :atpC         ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit)
Swiss-Prot:ATPE_PELUB   RecName: Full=ATP synthase epsilon chain;AltName: Full=ATP synthase F1 sector epsilon subunit;AltName: Full=F-ATPase epsilon subunit;

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  20/199 : Viruses  0/175   --->[See Alignment]
b.93.1
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->83 1fs0E PDBj 1e-08 30.8 %
:RPS:PDB   4->86 2e5yA PDBj 1e-18 22.0 %
:RPS:SCOP  5->83 1aqtA2  b.93.1.1 * 1e-16 32.1 %
:HMM:SCOP  4->87 1e79H2 b.93.1.1 * 2.6e-19 36.9 %
:RPS:PFM   7->83 PF02823 * ATP-synt_DE_N 2e-11 39.5 %
:HMM:PFM   5->83 PF02823 * ATP-synt_DE_N 3e-25 41.0 78/80  
:BLT:SWISS 1->130 ATPE_PELUB 9e-64 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21050.1 GT:GENE atpC GT:PRODUCT ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(227367..227759) GB:FROM 227367 GB:TO 227759 GB:DIRECTION - GB:GENE atpC GB:PRODUCT ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) GB:PROTEIN_ID AAZ21050.1 GB:DB_XREF GI:71062047 GB:GENE:GENE atpC LENGTH 130 SQ:AASEQ MSEEFKIEIVNPEKSFLSKEDVTEVVVPAFEGEMGILKDHISIISFLKPGIIKIFSKSGEDNYYVEDGIVEFKNNNLSVLTSSIFNIKDIDKDKISELLTQAEENSKNSDITDQNKYLVDQKIDVLKTLN GT:EXON 1|1-130:0| SW:ID ATPE_PELUB SW:DE RecName: Full=ATP synthase epsilon chain;AltName: Full=ATP synthase F1 sector epsilon subunit;AltName: Full=F-ATPase epsilon subunit; SW:GN Name=atpC; OrderedLocusNames=SAR11_0229; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(1);Complete proteome; Hydrogen ion transport; Ion transport; Membrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->130|ATPE_PELUB|9e-64|100.0|130/130| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 87->95|ikdidkdki| BL:PDB:NREP 1 BL:PDB:REP 5->83|1fs0E|1e-08|30.8|78/128| RP:PDB:NREP 1 RP:PDB:REP 4->86|2e5yA|1e-18|22.0|82/133| RP:PFM:NREP 1 RP:PFM:REP 7->83|PF02823|2e-11|39.5|76/80|ATP-synt_DE_N| HM:PFM:NREP 1 HM:PFM:REP 5->83|PF02823|3e-25|41.0|78/80|ATP-synt_DE_N| GO:PFM:NREP 4 GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF02823|IPR020546| GO:PFM GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|PF02823|IPR020546| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF02823|IPR020546| GO:PFM GO:0046961|"GO:proton-transporting ATPase activity, rotational mechanism"|PF02823|IPR020546| RP:SCP:NREP 1 RP:SCP:REP 5->83|1aqtA2|1e-16|32.1|78/85|b.93.1.1| HM:SCP:REP 4->87|1e79H2|2.6e-19|36.9|84/86|b.93.1.1|1/1|Epsilon subunit of F1F0-ATP synthase N-terminal domain| OP:NHOMO 42 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------1-----------------1-------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1------------------------------------------------------------1--111111-11111-----11-----------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ --------------------------------------------------------1-1---111---1---111---1--1111111-----1-1--------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 83.8 SQ:SECSTR #cccEEEEEEETTEEEEEEEEEcEEEEEETTEEEEEcTTcccEEEEEEEEEEEEEETTEEEEEEEEEEEEEEETTEEEEEEccEEETTccccTTTTTHHHHTHHHHcccc#################### DISOP:02AL 1-2, 100-116| PSIPRED cccEEEEEEEccccEEEccccEEEEEEEccccEEEEccccccEEEEEccEEEEEEEcccEEEEEEEccEEEEEccEEEEEEccEEEcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcc //