[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : atpE
DDBJ      :atpE         H+-transporting two-sector ATPase (subunit C)
Swiss-Prot:ATPL_PELUB   RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c;         Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein;

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.17.1
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->74 1yceA PDBj 5e-06 40.0 %
:RPS:SCOP  30->74 1ijpA  f.17.1.1 * 1e-08 24.4 %
:HMM:SCOP  4->76 1c99A_ f.17.1.1 * 4.5e-15 50.7 %
:RPS:PFM   30->74 PF00137 * ATP-synt_C 3e-04 46.7 %
:HMM:PFM   6->74 PF00137 * ATP-synt_C 2.7e-21 49.2 65/66  
:BLT:SWISS 1->75 ATPL_PELUB 4e-24 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20941.1 GT:GENE atpE GT:PRODUCT H+-transporting two-sector ATPase (subunit C) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 128123..128350 GB:FROM 128123 GB:TO 128350 GB:DIRECTION + GB:GENE atpE GB:PRODUCT H+-transporting two-sector ATPase (subunit C) GB:NOTE Old name Fo ATP Synthase Subunit C; old EC 3.6.1.34 GB:PROTEIN_ID AAZ20941.1 GB:DB_XREF GI:71061938 GB:GENE:GENE atpE LENGTH 75 SQ:AASEQ MELEAAKMIGAGLAAIALAGAGVGIGIIFGNYLSGAMRNPSAAQKQFPNLLLGFALAEATGLFGLVVALIILFAF GT:EXON 1|1-75:0| SW:ID ATPL_PELUB SW:DE RecName: Full=ATP synthase subunit c;AltName: Full=ATP synthase F(0) sector subunit c;AltName: Full=F-type ATPase subunit c; Short=F-ATPase subunit c;AltName: Full=Lipid-binding protein; SW:GN Name=atpE; OrderedLocusNames=SAR11_0117; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(0);Complete proteome; Hydrogen ion transport; Ion transport;Lipid-binding; Membrane; Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->75|ATPL_PELUB|4e-24|100.0|75/75| GO:SWS:NREP 10 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|CF(0)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0008289|"GO:lipid binding"|Lipid-binding| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 2 TM:REGION 9->31| TM:REGION 50->72| SEG 9->28|igaglaaialagagvgigii| BL:PDB:NREP 1 BL:PDB:REP 30->74|1yceA|5e-06|40.0|45/89| RP:PFM:NREP 1 RP:PFM:REP 30->74|PF00137|3e-04|46.7|45/70|ATP-synt_C| HM:PFM:NREP 1 HM:PFM:REP 6->74|PF00137|2.7e-21|49.2|65/66|ATP-synt_C| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00137|IPR002379| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00137|IPR002379| GO:PFM GO:0033177|"GO:proton-transporting two-sector ATPase complex, proton-transporting domain"|PF00137|IPR002379| RP:SCP:NREP 1 RP:SCP:REP 30->74|1ijpA|1e-08|24.4|45/79|f.17.1.1| HM:SCP:REP 4->76|1c99A_|4.5e-15|50.7|73/79|f.17.1.1|1/1|F1F0 ATP synthase subunit C| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------1-------------1-----------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 45 STR:RPRED 60.0 SQ:SECSTR #############################HHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc# DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //