[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : atpF
DDBJ      :atpF         H+-transporting two-sector ATPase (subunit b)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->136 PF00430 * ATP-synt_B 7e-10 34.1 %
:HMM:PFM   7->137 PF00430 * ATP-synt_B 5.5e-18 29.2 130/132  
:BLT:SWISS 4->150 ATPF_RHORU 1e-14 27.4 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20943.1 GT:GENE atpF GT:PRODUCT H+-transporting two-sector ATPase (subunit b) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 128936..129433 GB:FROM 128936 GB:TO 129433 GB:DIRECTION + GB:GENE atpF GB:PRODUCT H+-transporting two-sector ATPase (subunit b) GB:NOTE Old name Fo ATP Synthase Subunit b; old EC 3.6.1.34 GB:PROTEIN_ID AAZ20943.1 GB:DB_XREF GI:71061940 GB:GENE:GENE atpF LENGTH 165 SQ:AASEQ MVIDATFWVAISFLIFIGALVYLKIPQKINELLNKLILDIKNEIDESEKLRQEAKVLLDNAQNKLDTAQTVSNDILQQAKKDSDHLIIEMNDKFHKSSEIKKSLAENKISQMKEAALKEIKDVSIKIAVDSVKKIINTSVDKSKLDGLFEKNLEETKIALKKISS GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 4->150|ATPF_RHORU|1e-14|27.4|146/182| COIL:NAA 55 COIL:NSEG 1 COIL:REGION 27->81| TM:NTM 1 TM:REGION 3->25| RP:PFM:NREP 1 RP:PFM:REP 7->136|PF00430|7e-10|34.1|129/132|ATP-synt_B| HM:PFM:NREP 1 HM:PFM:REP 7->137|PF00430|5.5e-18|29.2|130/132|ATP-synt_B| GO:PFM:NREP 3 GO:PFM GO:0015078|"GO:hydrogen ion transmembrane transporter activity"|PF00430|IPR002146| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00430|IPR002146| GO:PFM GO:0045263|"GO:proton-transporting ATP synthase complex, coupling factor F(o)"|PF00430|IPR002146| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------1------------------------------------1--------1---1-------------------------------1-------------1----1----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 106-117, 164-165| PSIPRED ccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc //