[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : atpH
DDBJ      :atpH         H+-transporting two-sector ATPase (F0F1-type ATP synthase) delta chain
Swiss-Prot:ATPD_PELUB   RecName: Full=ATP synthase subunit delta;AltName: Full=ATP synthase F(1) sector subunit delta;AltName: Full=F-type ATPase subunit delta;         Short=F-ATPase subunit delta;

Homologs  Archaea  0/68 : Bacteria  432/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
a.70.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->114 2bo5A PDBj 1e-06 24.8 %
:RPS:PDB   12->117 2bo5A PDBj 1e-11 21.9 %
:RPS:SCOP  9->112 1abvA  a.70.1.1 * 2e-11 16.8 %
:HMM:SCOP  6->113 1abvA_ a.70.1.1 * 8.3e-16 29.5 %
:RPS:PFM   12->182 PF00213 * OSCP 2e-16 31.8 %
:HMM:PFM   12->182 PF00213 * OSCP 1.6e-43 32.9 170/172  
:BLT:SWISS 1->185 ATPD_PELUB e-100 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21054.1 GT:GENE atpH GT:PRODUCT H+-transporting two-sector ATPase (F0F1-type ATP synthase) delta chain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(231595..232152) GB:FROM 231595 GB:TO 232152 GB:DIRECTION - GB:GENE atpH GB:PRODUCT H+-transporting two-sector ATPase (F0F1-type ATP synthase) delta chain GB:PROTEIN_ID AAZ21054.1 GB:DB_XREF GI:71062051 GB:GENE:GENE atpH LENGTH 185 SQ:AASEQ MSKNKGFSETSAGRYSLALYELAVEANNLNEIEVHSASIINLITSSEDFKSLIKDPTNNKEDQLNALSKISEQYKLNELLTKFLSFLISKRRFFYVDKILKSFVETCSVKRGELKAELTSAKDLTENEINNIKEELTKNFSSKIKLNYKHDASLIGGLIVQVGSTMVDTSIKNKLQQIENRMIEA GT:EXON 1|1-185:0| SW:ID ATPD_PELUB SW:DE RecName: Full=ATP synthase subunit delta;AltName: Full=ATP synthase F(1) sector subunit delta;AltName: Full=F-type ATPase subunit delta; Short=F-ATPase subunit delta; SW:GN Name=atpH; OrderedLocusNames=SAR11_0233; SW:KW ATP synthesis; Cell inner membrane; Cell membrane; CF(1);Complete proteome; Hydrogen ion transport; Ion transport; Membrane;Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->185|ATPD_PELUB|e-100|100.0|185/185| GO:SWS:NREP 8 GO:SWS GO:0006754|"GO:ATP biosynthetic process"|ATP synthesis| GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|CF(1)| GO:SWS GO:0015992|"GO:proton transport"|Hydrogen ion transport| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0006810|"GO:transport"|Transport| BL:PDB:NREP 1 BL:PDB:REP 13->114|2bo5A|1e-06|24.8|101/120| RP:PDB:NREP 1 RP:PDB:REP 12->117|2bo5A|1e-11|21.9|105/120| RP:PFM:NREP 1 RP:PFM:REP 12->182|PF00213|2e-16|31.8|170/171|OSCP| HM:PFM:NREP 1 HM:PFM:REP 12->182|PF00213|1.6e-43|32.9|170/172|OSCP| GO:PFM:NREP 4 GO:PFM GO:0005886|"GO:plasma membrane"|PF00213|IPR000711| GO:PFM GO:0015986|"GO:ATP synthesis coupled proton transport"|PF00213|IPR000711| GO:PFM GO:0045261|"GO:proton-transporting ATP synthase complex, catalytic core F(1)"|PF00213|IPR000711| GO:PFM GO:0046933|"GO:hydrogen ion transporting ATP synthase activity, rotational mechanism"|PF00213|IPR000711| RP:SCP:NREP 1 RP:SCP:REP 9->112|1abvA|2e-11|16.8|101/105|a.70.1.1| HM:SCP:REP 6->113|1abvA_|8.3e-16|29.5|105/105|a.70.1.1|1/1|N-terminal domain of the delta subunit of the F1F0-ATP synthase| OP:NHOMO 601 OP:NHOMOORG 577 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------1----------------------------------------------------111----1------1--1-1-1-11--------------11111-111111-----111---1111111-11------11111-111-11-11--111----------11111111111111111-11-111111-111-1111111--111111111111111111--1-----1111------1-1-------------------------------------------------1-11-11111111-1-11111111--1--11-111111111-1---1---1-1-111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111----1111----111111-11111--1--1111-1-1111------------------------1111--111-----------11-11-11-1---1-11-1--111111-11---11--1111111-211111-11----------------------------1----1-111------11-1111-11111---111-11-111-1--11-1111111-11-1111111111111111111-------111111111111111111111--11--------------111111111------1-1--------------------1--1---1111-------------111111111111------------11-1-11---1111--1-111111-----------------1---11----1--------1------------ 11----1-1---11111--1111111-1111-11111111111---11111111--111111111----1--11111----1111111-1--11-1----111112-1--2--11121-1--1111121131-111-1--1-11-1111-1-121111111-111-11111121221126121124121-111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 109 STR:RPRED 58.9 SQ:SECSTR ########HHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHcHHHHTTTTcTTcccccHHHHHHHHHcccccccccTTHHHHHTTTTccccTHHHHHHHHHHHHHHHHccccc#################################################################### DISOP:02AL 1-6, 8-10, 184-185| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEEcHHHHcEEEEEEccEEEEHHHHHHHHHHHHHHHcc //