[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : azoR
DDBJ      :azoR         [acyl-carrier-protein] phosphodiesterase
Swiss-Prot:AZOR_PELUB   RecName: Full=FMN-dependent NADH-azoreductase;         EC=1.7.-.-;AltName: Full=FMN-dependent NADH-azo compound oxidoreductase;AltName: Full=Azo-dye reductase;

Homologs  Archaea  0/68 : Bacteria  300/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.23.5
:193 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   33->175 2d5iA PDBj 2e-21 35.9 %
:RPS:PDB   2->193 2d5iA PDBj 2e-22 30.4 %
:RPS:SCOP  2->192 1d4aA  c.23.5.3 * 7e-22 22.2 %
:HMM:SCOP  1->192 1dxqA_ c.23.5.3 * 3.3e-46 33.7 %
:RPS:PFM   46->172 PF02525 * Flavodoxin_2 3e-14 37.0 %
:HMM:PFM   1->191 PF02525 * Flavodoxin_2 9e-42 33.1 181/196  
:BLT:SWISS 1->193 AZOR_PELUB e-100 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21600.1 GT:GENE azoR GT:PRODUCT [acyl-carrier-protein] phosphodiesterase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 760165..760746 GB:FROM 760165 GB:TO 760746 GB:DIRECTION + GB:GENE azoR GB:PRODUCT [acyl-carrier-protein] phosphodiesterase GB:NOTE renamed azoR GB:PROTEIN_ID AAZ21600.1 GB:DB_XREF GI:71062597 GB:GENE:GENE azoR LENGTH 193 SQ:AASEQ MKIYQIDSSARKEGSSSRALAKKLLNKIKKPGDEVIYRDLDDDMLFVSGLTESGMKIAEKDQTEEHKKMFELSDKLVSELKESDIIIISAPIYNYGPPATLKAWCDLAARIGETFKFKPNGRREGLLKNKQAYLVITSGGTKLNSSEDFLTPWLKFILNFFGIEKVEVISADQMALDYEKSIKEAEKQIENII GT:EXON 1|1-193:0| SW:ID AZOR_PELUB SW:DE RecName: Full=FMN-dependent NADH-azoreductase; EC=1.7.-.-;AltName: Full=FMN-dependent NADH-azo compound oxidoreductase;AltName: Full=Azo-dye reductase; SW:GN Name=azoR; OrderedLocusNames=SAR11_0782; SW:KW Complete proteome; Flavoprotein; FMN; NAD; Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->193|AZOR_PELUB|e-100|100.0|193/193| GO:SWS:NREP 2 GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| SEG 19->30|alakkllnkikk| BL:PDB:NREP 1 BL:PDB:REP 33->175|2d5iA|2e-21|35.9|142/200| RP:PDB:NREP 1 RP:PDB:REP 2->193|2d5iA|2e-22|30.4|191/200| RP:PFM:NREP 1 RP:PFM:REP 46->172|PF02525|3e-14|37.0|127/193|Flavodoxin_2| HM:PFM:NREP 1 HM:PFM:REP 1->191|PF02525|9e-42|33.1|181/196|Flavodoxin_2| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF02525|IPR003680| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02525|IPR003680| GO:PFM GO:0050662|"GO:coenzyme binding"|PF02525|IPR003680| RP:SCP:NREP 1 RP:SCP:REP 2->192|1d4aA|7e-22|22.2|189/273|c.23.5.3| HM:SCP:REP 1->192|1dxqA_|3.3e-46|33.7|190/0|c.23.5.3|1/1|Flavoproteins| OP:NHOMO 402 OP:NHOMOORG 302 OP:PATTERN -------------------------------------------------------------------- 1------------------------------------------1--------1------------------------------------------------1---4----------------------------------------1--------------------211------------------------11111-11-1-------11-1-12-----11-----1111-------------------1---------------------1-----------------------------------------------1---1-------1-1-----1111----------------------11--------------11222----1---------------11-1111--1--211122114111111111211111-2----------1111--------------------------------11--2-111-11442312111122311111116222212--2211-21111211-13-1--211----------111----1----------1--1--1-------1-----------------------------2111-1221-11211111-122111--11-----1--------1122-211111111-11-1111211111112111111222121111111111111111111311111111-111111111111-----------1--1212----1--11112---22222-----113333253232223-1111--------1---1-----11-1112212-1112--------------------------------1---------------------------11- --------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 192 STR:RPRED 99.5 SQ:SECSTR #EEEEEEccccGGGcHHHHHHHHHHHHHHHTTcEEEEEETTTTTccccTTGGGGGccccccccHHHHHHHHHHHHHHHHHHHccEEEEEccEETTEEcHHHHHHHHHHcccTTTEEccTTcccEEcccccEEEEEEEcccccTTcTTccHHHHHHHHHHHTTcccEEEEEccGGGcHHHHHHHHHHHHHHHHH PSIPRED cEEEEEEccccccccHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHHHc //