[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : bcp
DDBJ      :bcp          bacterioferritin comigratory protein
Swiss-Prot:             

Homologs  Archaea  30/68 : Bacteria  696/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:155 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->41 3hy2B PDBj 2e-04 53.8 %
:BLT:PDB   13->138 3gknA PDBj 4e-19 33.3 %
:RPS:PDB   3->151 2bmxA PDBj 1e-16 21.8 %
:RPS:SCOP  3->151 1psqA  c.47.1.10 * 2e-22 22.0 %
:HMM:SCOP  1->151 1x0rA1 c.47.1.10 * 7.4e-52 44.8 %
:RPS:PFM   4->130 PF00578 * AhpC-TSA 7e-16 38.3 %
:HMM:PFM   4->132 PF00578 * AhpC-TSA 1.9e-42 45.5 123/124  
:BLT:SWISS 3->152 BCP_BACSU 4e-30 42.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21636.1 GT:GENE bcp GT:PRODUCT bacterioferritin comigratory protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(793367..793834) GB:FROM 793367 GB:TO 793834 GB:DIRECTION - GB:GENE bcp GB:PRODUCT bacterioferritin comigratory protein GB:PROTEIN_ID AAZ21636.1 GB:DB_XREF GI:71062633 GB:GENE:GENE bcp LENGTH 155 SQ:AASEQ MFKINSKAPLFKLNSTDGEIYSLKDSLGKYVVLYFYPKDDTPGCTIETNDFNKLLPKFKKLNCEIFGISKDDLKSHHKFKEKFKIKFDLLSDVELNILKKYKVWAKKKFMGREFMGIVRTTFLIDPNGKIVKIWDNVKVKDHAKEVFDTLKNSIN GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 3->152|BCP_BACSU|4e-30|42.7|150/157| SEG 51->62|fnkllpkfkkln| SEG 78->87|kfkekfkikf| BL:PDB:NREP 2 BL:PDB:REP 3->41|3hy2B|2e-04|53.8|39/184| BL:PDB:REP 13->138|3gknA|4e-19|33.3|126/159| RP:PDB:NREP 1 RP:PDB:REP 3->151|2bmxA|1e-16|21.8|142/168| RP:PFM:NREP 1 RP:PFM:REP 4->130|PF00578|7e-16|38.3|120/122|AhpC-TSA| HM:PFM:NREP 1 HM:PFM:REP 4->132|PF00578|1.9e-42|45.5|123/124|AhpC-TSA| GO:PFM:NREP 2 GO:PFM GO:0016209|"GO:antioxidant activity"|PF00578|IPR000866| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00578|IPR000866| RP:SCP:NREP 1 RP:SCP:REP 3->151|1psqA|2e-22|22.0|141/163|c.47.1.10| HM:SCP:REP 1->151|1x0rA1|7.4e-52|44.8|143/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 911 OP:NHOMOORG 741 OP:PATTERN ------2222222222-1-------1111-1--------------1-1-11-1----1111211--11 2121211111111111111-111111111111111111111111-1111111232111--11111111111-111111---11212131111-1111--1-2221321-1--------------12122211223111121---3-42443333344333333223344433224333234332231111-1111111111111111111111111111111111------1211111111111111111111-----------------------------------------------------------------------1-11-------1-1-1---1111-1-1-111-----------111-1--1-111111111111111111111111111111-111-1111111111111111111111111111111-1111111111111111111-1111111111111141111-1111-11-111111121-1111111111111111111111111111111111111111111111111112342311111111111222211-1---1-1-111-1-11-11111--124--111111111111111111111111111111111211111111111211112122122--111111-----11111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-211111111111111111111111111111111111211111111111111111111111----1---21111111111111111111111111111111-112222------------------------------------111111-111--- ----74-------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------1--14111--1112-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 155 STR:RPRED 100.0 SQ:SECSTR cccccGGGcccccGGGGEEEEETTccTTcEEEEEEcccTTccccHHHHHHHHHTHHHHHTTTEEEEEEEcccHHHHHHHcTTGGGccccEEcTTcHHHHHHTcccTTcccccTTccccEEEEEEcTTccEEEEEEETTccccHHHHHHHHHTcHH PSIPRED ccccccccccEEEEcccccEEEHHHHcccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHcccEEEEEccccHHHHHcccccccccccccccccccEEEEEccccEEEEEEccccccccHHHHHHHHHHHHc //