[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : capM
DDBJ      :capM         glycosyl transferase
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  298/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
c.87.1
:384 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   157->370 2bisA PDBj 4e-12 27.1 %
:RPS:PDB   2->384 3c4qB PDBj 6e-33 16.7 %
:RPS:SCOP  7->383 2iv7A1  c.87.1.8 * 9e-31 14.2 %
:HMM:SCOP  5->384 2bisA1 c.87.1.8 * 2.9e-72 27.3 %
:RPS:PFM   198->350 PF00534 * Glycos_transf_1 2e-15 38.6 %
:HMM:PFM   194->350 PF00534 * Glycos_transf_1 3.2e-36 35.1 151/172  
:BLT:SWISS 105->382 Y1069_METJA 6e-15 29.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21259.1 GT:GENE capM GT:PRODUCT glycosyl transferase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 430651..431805 GB:FROM 430651 GB:TO 431805 GB:DIRECTION + GB:GENE capM GB:PRODUCT glycosyl transferase GB:NOTE group 1 family protein GB:PROTEIN_ID AAZ21259.1 GB:DB_XREF GI:71062256 GB:GENE:GENE capM LENGTH 384 SQ:AASEQ MSSELKVLQVIPKLGYGGAETGCYDLAHYLPENNCGSYIVTSGGELLKFIDKKKVKVIKLPVHSKNPFLMLFNSIALIFIILLNNISIVHARSRAPAWSCLFATKITRRKFVTTFHGTYNFKNSIKKFYNSVMVRSDLIIAGSNFIFSHINQNYPKFLDLKKKFLVIFRGINVDYFELSTILDSEENRLISDWEVDRNKKTILMPGRLTAWKGQETFIEALNLVNKELGYESFNAVILGSDQERDIYTKKIKRLAEQYRLTSQLKFIEHCKNMPLAYKISDIVVSASVEPEAFGRVAVEAQSMEKPIIASDIGGSNETIIDNVTGFLFQSGNAEALSKKIIEVLQLDESRLKSIGIEGRKNIIKKFNVEKMCFSTYSEYKKLLN GT:EXON 1|1-384:0| BL:SWS:NREP 1 BL:SWS:REP 105->382|Y1069_METJA|6e-15|29.2|253/392| SEG 46->60|llkfidkkkvkvikl| SEG 71->88|lfnsialifiillnnisi| BL:PDB:NREP 1 BL:PDB:REP 157->370|2bisA|4e-12|27.1|207/440| RP:PDB:NREP 1 RP:PDB:REP 2->384|3c4qB|6e-33|16.7|366/393| RP:PFM:NREP 1 RP:PFM:REP 198->350|PF00534|2e-15|38.6|145/165|Glycos_transf_1| HM:PFM:NREP 1 HM:PFM:REP 194->350|PF00534|3.2e-36|35.1|151/172|Glycos_transf_1| GO:PFM:NREP 1 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00534|IPR001296| RP:SCP:NREP 1 RP:SCP:REP 7->383|2iv7A1|9e-31|14.2|358/370|c.87.1.8| HM:SCP:REP 5->384|2bisA1|2.9e-72|27.3|370/0|c.87.1.8|1/1|UDP-Glycosyltransferase/glycogen phosphorylase| OP:NHOMO 498 OP:NHOMOORG 343 OP:PATTERN 11--1-11-------13------1--------122232-11---1-31--124-2322212------- ----1-11111--21---------------------111--1--1----------------------1---------------1--11111--1-----1-21211---------------------11--1-31111122-125-4-23111------------111151--1-----1----11--221-21--1-11--2--121--222131-23-3-3--------33---------------1---------1------------1---1-------------1331221-112--------------11---111-1--11----------111111---15--1-1----624-31232131----2-1111--1--2-11---1----1------------11111113-11-111--------21-111-------1--1111111111111111----------112111121221221----1---------11----1-------11-------12--11--------------2----22-1------1-1--111--1111-11--1----11--21--2------3-22212----1----------33-111----22-3-1-1---------------1------2--3----------11--11--1-----11--11----1-------1--1--22111-1-1-1---1111-1-1-----------------1----------------2-1---------------1111211-11-------------------211111111-2331------1-32----------1111-----------------------------------------------2-----22---1 --11-----------------------------------------------------------------------------------------------------------------------1------------------1----------1-----112-----------1-1---------1223-21------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 384 STR:RPRED 100.0 SQ:SECSTR ccTTccTTccTTcTTccHHHHHHHHHHHHHHHTTcEEEEEEEcccGGGccEEEEETTEEEEEEcccccHHHHHHHHHHHHHTTccccEEEEEcHHHHHHHHHHHHHHTccEEEEccccTTccccHHHHHHHHHHHccEEEEccHHHHHHHHHHHcccGGcGGGEEEccccccTTTccccccHTTHHHHHHHHTTcccccEEEEEEccccGGGcHHHHHHHHHHHHHHGHcTTcTTccEEEEEEccHHHHccHHHHHHTTcGGGEEEEccHHHHHHHHHHccEEEEcccccccccHHHHHHHHTTccEEEEccTTHHHHcccTTTEEEEccccHHHHHHHHHHHHcTcHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHH DISOP:02AL 1-2| PSIPRED cccccEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHHcccccccEEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHccEEEEEccccccccHHHHHHHHccccEEEEcccccHHHHccccEEEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcc //