[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : carA
DDBJ      :carA         Carbamoyl-phosphate synthase small chain
Swiss-Prot:             

Homologs  Archaea  61/68 : Bacteria  826/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
c.23.16c.8.3
:398 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->385 1t36B PDBj e-101 50.3 %
:RPS:PDB   18->385 1a9xB PDBj 4e-93 47.4 %
:RPS:SCOP  18->150 1a9xB1  c.8.3.1 * 3e-54 48.1 %
:RPS:SCOP  169->385 1a9xB2  c.23.16.1 * 8e-74 53.5 %
:HMM:SCOP  16->166 1a9xB1 c.8.3.1 * 1.1e-49 43.7 %
:HMM:SCOP  169->398 1a9xB2 c.23.16.1 * 2.1e-63 35.8 %
:RPS:PFM   21->146 PF00988 * CPSase_sm_chain 6e-34 47.6 %
:RPS:PFM   217->385 PF00117 * GATase 3e-22 38.3 %
:HMM:PFM   18->147 PF00988 * CPSase_sm_chain 2.4e-53 54.6 130/131  
:HMM:PFM   210->387 PF00117 * GATase 5.1e-50 38.4 177/192  
:BLT:SWISS 18->385 CARA_BRAJA e-119 54.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20865.1 GT:GENE carA GT:PRODUCT Carbamoyl-phosphate synthase small chain GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 46155..47351 GB:FROM 46155 GB:TO 47351 GB:DIRECTION + GB:GENE carA GB:PRODUCT Carbamoyl-phosphate synthase small chain GB:PROTEIN_ID AAZ20865.1 GB:DB_XREF GI:71061862 GB:GENE:GENE carA LENGTH 398 SQ:AASEQ MIKKAKKISSNKISQIHTGVLVLENKTIFKGVGIGYQGTATGEVCFNTSLTGYQEIISDPSYAGQIINFTFPHVGNVGTNKEDLESDKVWTKGVIFNSEITNPSNYRSLANLDLWLKKNKIVGITGLDTRGLTNYIRDKGAPKGTISFSSKGNFNISKLANITTKWSGLNNLDLAEQVTTKKNYIWSGFKTWKKETGYLKNKKNSLHVVAIDYGIKKNILRYFSDLNCKVTVVSCKTSAKDILKLKPNGIFLSNGPGDPAATGKYAIGIIKELVKNNLPIFGICLGHQILALTLGAKTKKMKLGHRGANHPVKNLIKDNVEITSQNHGFEIVRASLPKNIEVTHKSLFDNCIEGIKLKNKPVFSVQYHPESNPGPQDSVYLFEEFINNIKKNAKKKRS GT:EXON 1|1-398:0| BL:SWS:NREP 1 BL:SWS:REP 18->385|CARA_BRAJA|e-119|54.8|367/396| SEG 2->14|ikkakkissnkis| SEG 386->396|innikknakkk| BL:PDB:NREP 1 BL:PDB:REP 16->385|1t36B|e-101|50.3|366/379| RP:PDB:NREP 1 RP:PDB:REP 18->385|1a9xB|4e-93|47.4|363/378| RP:PFM:NREP 2 RP:PFM:REP 21->146|PF00988|6e-34|47.6|126/131|CPSase_sm_chain| RP:PFM:REP 217->385|PF00117|3e-22|38.3|167/185|GATase| HM:PFM:NREP 2 HM:PFM:REP 18->147|PF00988|2.4e-53|54.6|130/131|CPSase_sm_chain| HM:PFM:REP 210->387|PF00117|5.1e-50|38.4|177/192|GATase| GO:PFM:NREP 3 GO:PFM GO:0004086|"GO:carbamoyl-phosphate synthase activity"|PF00988|IPR002474| GO:PFM GO:0006807|"GO:nitrogen compound metabolic process"|PF00988|IPR002474| GO:PFM GO:0003824|"GO:catalytic activity"|PF00117|IPR000991| RP:SCP:NREP 2 RP:SCP:REP 18->150|1a9xB1|3e-54|48.1|133/151|c.8.3.1| RP:SCP:REP 169->385|1a9xB2|8e-74|53.5|215/228|c.23.16.1| HM:SCP:REP 16->166|1a9xB1|1.1e-49|43.7|151/151|c.8.3.1|1/1|Carbamoyl phosphate synthetase, small subunit N-terminal domain| HM:SCP:REP 169->398|1a9xB2|2.1e-63|35.8|226/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 1992 OP:NHOMOORG 1078 OP:PATTERN 11-1-12222222222-222222121111121231223222222211213332212--211111--24 2211311111122222211-1122211111122222111122221211111122222222121111112112222222211222212211212111-1111221211111--------------122222222122222222222222412231211222221221122222223222223222231132112233333333233333323223233332234333333333211111111111111111111131411433223333111222311114442111232222222222222222222222222211222111134-23---111-1-1233332222-3-11222233321111422221-31122222211111321111111111122222222222-22222111212122222222222222212222222212222222222222122221111111111---------------11112111112222222222222222222222222222222222222222222212112222222222222221222222212211111111111122222222211111221222212222211111111112222222212111221221111121221112211122111222111111112222222222222222-222222222222222222211122322111111111111111122222222212222222222221122221222222221121111-11----1--111222222222222222222222222222211111111212222222222212122222222222111121222222--------------------------------------2--21222221 21--112-311-1121223222222222223332222322232332222222222222222232222222222321212222222224-22323232223221354-23143322322121222432215H2-3221121212211221222121222213-13211211611412221I1222241432122233242 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 370 STR:RPRED 93.0 SQ:SECSTR ###############ccEEEEEETTccEEEEEEccccEEEEEEEEEEcccccHHHHHTcGGGcTEEEEEccccccTTcccGGGcccccccccEEEccccccccccTTccccHHHHHHHTTcEEEEcccHHHHHHHHHHHccEEEEEccEEcccccHHHHHHHHHHccccTTcccHHHHcccccEEEcccccccTTTcccccccGGGcEEEEEccccHHHHHHHHHTTEEEEEEETTccHHHHHTTcccEEEEcccccccTTcHHHHHHHHHHHHTTccccEEEEHHHHHHHHHTTccEEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEEccTTccTTEEEEEEETTTccEEEEEEccccEEEEcccTTccccccTTTHHHHHH############# DISOP:02AL 1-12, 394-398| PSIPRED ccccccccccccHHHccccEEEEEcccEEEEEEEccccEEEEEEEEEcccccccEEccccccccEEEEEEcccccccccccccccccccEEEEEEEEEccccccccHHHccHHHHHHHcccEEEEcccHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHcccccccccEEEccccccEEEccccccccccccccccccccEEEEEEccHHHHHHHHHHHcccEEEEEEccccHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHccEEEEcccccccEEEccEEcccccEEEEEEEcEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcc //