[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : carD
DDBJ      :carD         hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  217/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.34.18
:299 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  98->178 2eyqA1 b.34.18.1 * 8.2e-11 27.5 %
:RPS:PFM   109->158 PF02559 * CarD_TRCF 3e-06 44.0 %
:RPS:PFM   154->241 PF05889 * SLA_LP_auto_ag 5e-05 33.7 %
:HMM:PFM   108->215 PF02559 * CarD_TRCF 1.7e-22 34.7 95/98  
:BLT:SWISS 109->251 YDEB_BACSU 3e-11 26.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21245.1 GT:GENE carD GT:PRODUCT hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(410672..411571) GB:FROM 410672 GB:TO 411571 GB:DIRECTION - GB:GENE carD GB:PRODUCT hypothetical protein GB:NOTE similar to Myxococcus xanthus CarD; similar to COG1329: Transcriptional regulators GB:PROTEIN_ID AAZ21245.1 GB:DB_XREF GI:71062242 GB:GENE:GENE carD LENGTH 299 SQ:AASEQ MKKTSTTNILAKIFKKTPEKKVKKKTKAKVAKKPTLPKAKVVKKKIPVKKTKTIKATPTKIKKNLKTVSKKAVPEKVEIKTDNLRISKSNEVKPEIKKVKKQETEKREYKVKDYVVYPKHGVGQITEFKKINIGGIDVETYVLKFEKDKANGMVPVNKQSHLRPLATINQVNKCISILKSKPKIKRSMWSRRAQEYEAKISSGKIYELAEVVRDLNKGDDLMVDQSYSERQLFEKAYERILSEFQIVMGISLEDTQKKLDKALKRNLEGQAKAVAAPTKIKEPITESDTDSEPITDTED GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 109->251|YDEB_BACSU|3e-11|26.8|142/153| SEG 12->63|kifkktpekkvkkktkakvakkptlpkakvvkkkipvkktktikatptkikk| RP:PFM:NREP 2 RP:PFM:REP 109->158|PF02559|3e-06|44.0|50/100|CarD_TRCF| RP:PFM:REP 154->241|PF05889|5e-05|33.7|83/388|SLA_LP_auto_ag| HM:PFM:NREP 1 HM:PFM:REP 108->215|PF02559|1.7e-22|34.7|95/98|CarD_TRCF| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF02559|IPR003711| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02559|IPR003711| HM:SCP:REP 98->178|2eyqA1|8.2e-11|27.5|80/0|b.34.18.1|1/1|CarD-like| OP:NHOMO 218 OP:NHOMOORG 217 OP:PATTERN -------------------------------------------------------------------- -1-1-1-111111111111-11111111111111111111-------1-11----11-------11-11111111111-------------------------------------------------------------------------------------------------------------------1-------1-----1-1----1--2---------------------------------------------------------------------------------------------------------1-1------------1---------11-1--111111111111---1------111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111----------111111111111111----111111-----------------------------------------------------------------------11111111111111--------1-11111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 16-39, 56-77, 81-109, 221-226, 264-279, 295-299| PSIPRED ccccHHHHHHHHHHHHcHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHccccccccccccHHHHcHHHHccccccccccHHHcccccccEEEEccccEEEEEEEEEEEEccEEEEEEEEEEEcccEEEEEEccHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccccccccccccc //