[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ccmB
DDBJ      :ccmB         conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  74/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.34.17
:106 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->95 1vbvA1  b.34.17.1 * 8e-16 28.2 %
:HMM:SCOP  5->99 1vbvA1 b.34.17.1 * 1.9e-32 52.7 %
:RPS:PFM   6->93 PF08755 * YccV-like 4e-18 51.1 %
:HMM:PFM   6->102 PF08755 * YccV-like 2.6e-39 51.5 97/100  
:BLT:SWISS 7->92 HSPQ_PECCP 2e-09 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21109.1 GT:GENE ccmB GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(289675..289995) GB:FROM 289675 GB:TO 289995 GB:DIRECTION - GB:GENE ccmB GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID AAZ21109.1 GB:DB_XREF GI:71062106 GB:GENE:GENE ccmB LENGTH 106 SQ:AASEQ MAIQKAKFSIGDIVKHKHFEFRGVIYDVDFEFNNSEEWYQSIPKNVRPRKDQPFYHLLAENDEITYEAYVSEQNLLMDDSEDPIKHPLIEEIFSGKRGSSYFKPSN GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 7->92|HSPQ_PECCP|2e-09|33.3|84/102| RP:PFM:NREP 1 RP:PFM:REP 6->93|PF08755|4e-18|51.1|88/102|YccV-like| HM:PFM:NREP 1 HM:PFM:REP 6->102|PF08755|2.6e-39|51.5|97/100|YccV-like| RP:SCP:NREP 1 RP:SCP:REP 6->95|1vbvA1|8e-16|28.2|71/77|b.34.17.1| HM:SCP:REP 5->99|1vbvA1|1.9e-32|52.7|91/0|b.34.17.1|1/1|YccV-like| OP:NHOMO 77 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111221111111111111111111-11111111111-11-11111111111-111111111111---------------1-----------------------------11111------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1--1--------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 42-45, 104-106| PSIPRED cccccccccccEEEEEEEcccEEEEEccccccccccHHHHHccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccccHHHHcccccccccccccc //