[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ccmC
DDBJ      :ccmC         heme exporter protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  371/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:236 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   96->139 PF01578 * Cytochrom_C_asm 3e-04 38.6 %
:HMM:PFM   20->180 PF01578 * Cytochrom_C_asm 4.9e-30 26.6 158/214  
:BLT:SWISS 7->202 CCMC_SHIFL 2e-42 40.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21108.1 GT:GENE ccmC GT:PRODUCT heme exporter protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(288782..289492) GB:FROM 288782 GB:TO 289492 GB:DIRECTION - GB:GENE ccmC GB:PRODUCT heme exporter protein GB:NOTE CcmC GB:PROTEIN_ID AAZ21108.1 GB:DB_XREF GI:71062105 GB:GENE:GENE ccmC LENGTH 236 SQ:AASEQ MFKYFEPNKIFAITSKAPKYVLFLFIIVLTIGLTEALILSPEDYKQSDAVRIMYVHVPAAWISLGIFTSLAFLSVGSFVFKNKNFALIAKSLAPSGFIFNIIALGTGSIWGKPTWGTWWAWDARITSMLILALFYGMYLLAWRIYEDKEQVIKVTSLIAILGVVNVPIIKFSVDWWNTLHQPASINILSTNTAIHPSMLVPLGIMTAAFALFSLLIFLMKYNTELIKVKNKGLDRL GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 7->202|CCMC_SHIFL|2e-42|40.1|192/245| TM:NTM 6 TM:REGION 17->39| TM:REGION 54->76| TM:REGION 87->109| TM:REGION 124->146| TM:REGION 153->175| TM:REGION 195->217| SEG 207->218|aafalfsllifl| RP:PFM:NREP 1 RP:PFM:REP 96->139|PF01578|3e-04|38.6|44/212|Cytochrom_C_asm| HM:PFM:NREP 1 HM:PFM:REP 20->180|PF01578|4.9e-30|26.6|158/214|Cytochrom_C_asm| GO:PFM:NREP 3 GO:PFM GO:0006461|"GO:protein complex assembly"|PF01578|IPR002541| GO:PFM GO:0008535|"GO:respiratory chain complex IV assembly"|PF01578|IPR002541| GO:PFM GO:0016020|"GO:membrane"|PF01578|IPR002541| OP:NHOMO 414 OP:NHOMOORG 384 OP:PATTERN ---1--------------1----11------1-----------------11-1--------------- 1111----------------------------------------------------------1----------------1-1------------------------1--1------------------------1-11111---11-------------------------------------11111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--------1--111111111111111111111111111111111-11111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1-----------------------111221111-11----1-1---11-----1-------121111-----1111111111-------------11-----------------------------11-111111111111111111111111111---111-------11--1-1111111-111-111111111111111111111111---2222222222222221111111111-111111111111---1-----1111111-1111111111111111-------1111111111121111111111----------1111111111111111222221231111111---11--------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------1--2-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 182-197, 235-236| PSIPRED cccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //