[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ccmD
DDBJ      :ccmD         Heme exporter protein D
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->35 PF04995 * CcmD 7.2e-08 34.6 26/46  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21107.1 GT:GENE ccmD GT:PRODUCT Heme exporter protein D GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(288558..288785) GB:FROM 288558 GB:TO 288785 GB:DIRECTION - GB:GENE ccmD GB:PRODUCT Heme exporter protein D GB:NOTE CcmD GB:PROTEIN_ID AAZ21107.1 GB:DB_XREF GI:71062104 GB:GENE:GENE ccmD LENGTH 75 SQ:AASEQ MINEIISMNGYGAYVWSAFSFTLISFTALYFVTKLQLSKEQKRFASKFGSLNVEKARAARSQNINREILSNTSNI GT:EXON 1|1-75:0| TM:NTM 1 TM:REGION 15->37| HM:PFM:NREP 1 HM:PFM:REP 10->35|PF04995|7.2e-08|34.6|26/46|CcmD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 57-63, 72-75| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHcccccc //