[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ccmE
DDBJ      :ccmE         Cytochrome c-type biogenesis protein
Swiss-Prot:CCME_PELUB   RecName: Full=Cytochrome c-type biogenesis protein ccmE;AltName: Full=Cytochrome c maturation protein E;AltName: Full=Heme chaperone ccmE;

Homologs  Archaea  0/68 : Bacteria  334/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.40.9
:139 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->136 1lizA PDBj 5e-20 44.8 %
:RPS:SCOP  34->123 1j6qA  b.40.9.1 * 4e-09 42.2 %
:HMM:SCOP  31->136 1sr3A_ b.40.9.1 * 4.8e-36 51.9 %
:RPS:PFM   7->131 PF03100 * CcmE 4e-29 48.8 %
:HMM:PFM   6->131 PF03100 * CcmE 1e-45 46.0 126/131  
:BLT:SWISS 1->139 CCME_PELUB 3e-75 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21106.1 GT:GENE ccmE GT:PRODUCT Cytochrome c-type biogenesis protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(288128..288547) GB:FROM 288128 GB:TO 288547 GB:DIRECTION - GB:GENE ccmE GB:PRODUCT Cytochrome c-type biogenesis protein GB:PROTEIN_ID AAZ21106.1 GB:DB_XREF GI:71062103 GB:GENE:GENE ccmE LENGTH 139 SQ:AASEQ MYGKKVKLRFIFLALILASVILTVFLVLQSLKENVVYFQSPSEIKSLIELNKKKIRVGGMVKEQSIFIDSDKVNFVITDFKNEINIVYTGAVPNLFAEGKGVVAEGFLKDKNYFTATKILAKHDENYMPPEVKEALGDK GT:EXON 1|1-139:0| SW:ID CCME_PELUB SW:DE RecName: Full=Cytochrome c-type biogenesis protein ccmE;AltName: Full=Cytochrome c maturation protein E;AltName: Full=Heme chaperone ccmE; SW:GN Name=ccmE; Synonyms=cycJ; OrderedLocusNames=SAR11_0285; SW:KW Cell inner membrane; Cell membrane; Complete proteome;Cytochrome c-type biogenesis; Heme; Iron; Membrane; Metal-binding;Signal-anchor; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->139|CCME_PELUB|3e-75|100.0|139/139| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell inner membrane| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0017004|"GO:cytochrome complex assembly"|Cytochrome c-type biogenesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 1 TM:REGION 9->31| BL:PDB:NREP 1 BL:PDB:REP 31->136|1lizA|5e-20|44.8|105/114| RP:PFM:NREP 1 RP:PFM:REP 7->131|PF03100|4e-29|48.8|125/131|CcmE| HM:PFM:NREP 1 HM:PFM:REP 6->131|PF03100|1e-45|46.0|126/131|CcmE| GO:PFM:NREP 3 GO:PFM GO:0005886|"GO:plasma membrane"|PF03100|IPR004329| GO:PFM GO:0017003|"GO:protein-heme linkage"|PF03100|IPR004329| GO:PFM GO:0017004|"GO:cytochrome complex assembly"|PF03100|IPR004329| RP:SCP:NREP 1 RP:SCP:REP 34->123|1j6qA|4e-09|42.2|90/100|b.40.9.1| HM:SCP:REP 31->136|1sr3A_|4.8e-36|51.9|106/0|b.40.9.1|1/1|Heme chaperone CcmE| OP:NHOMO 375 OP:NHOMOORG 342 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------11-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111-111121121111111111111111112111111111111111111111111-11111111111111111111111111-11-1-----------------------111221111-11----1-1---11-----1-------121111-----------------------------------------------------------11-111111111111111111111111111---111-------11--1-11111111111-111111111111111111111111---222222222222222211111111--111111111111---1-----1111111-1111111111111111-------1111111111121111111111----------1111111111111111222222231111111-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------1-1-----------------------------------------------------------------1---------1112-1-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 76.3 SQ:SECSTR ##############################ccccccccccTTTTcccccTTcEEEEEEEEEcTTTcEEcccEEEEEEEccccEEEEEEEccccTTccTTcEEEEEEEEccccEEEEcccccccccccccHHHHTcc### DISOP:02AL 1-5, 135-139| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcHHHHHccccccccEEEEEEEEEccEEEEcccEEEEEEEEcccEEEEEEEEEcccHHHcccEEEEEEEEccccEEEEEEEEEEcccccccHHHHHHHHcc //