[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ccmG
DDBJ      :ccmG         Cytochrome C biogenesis protein ccmG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  396/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->97 1fb0B PDBj 7e-05 35.0 %
:BLT:PDB   68->170 1kngA PDBj 2e-28 44.7 %
:RPS:PDB   32->173 2b1kA PDBj 2e-21 35.3 %
:RPS:SCOP  67->167 1z5yE1  c.47.1.10 * 4e-35 45.0 %
:HMM:SCOP  42->168 1z5yE1 c.47.1.10 * 4.3e-28 35.8 %
:RPS:PFM   68->159 PF08534 * Redoxin 7e-20 44.0 %
:HMM:PFM   40->162 PF08534 * Redoxin 2.9e-18 18.5 119/146  
:BLT:SWISS 58->97 TRXM_SPIOL 2e-04 35.0 %
:BLT:SWISS 68->170 CYCY_BRAJA 6e-28 44.7 %
:PROS 68->86|PS00194|THIOREDOXIN_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21104.1 GT:GENE ccmG GT:PRODUCT Cytochrome C biogenesis protein ccmG GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(285731..286252) GB:FROM 285731 GB:TO 286252 GB:DIRECTION - GB:GENE ccmG GB:PRODUCT Cytochrome C biogenesis protein ccmG GB:PROTEIN_ID AAZ21104.1 GB:DB_XREF GI:71062101 GB:GENE:GENE ccmG LENGTH 173 SQ:AASEQ MKNKFSLFVVVIFLSFCFVIFYKGLNTPNNYTPKVNEKKNIPTFKAKDFYSNNYVNSEKIFEENIFYIVNIWASWCVPCRTEHPLLMQLSKNQSIKLIGLNYRDNFNNAKKFINDLGNPYSRILIDKDGTLGVEFGAYGVPETFLIDKNKDIIKKFVGPINQEIVSEIKLIIK GT:EXON 1|1-173:0| BL:SWS:NREP 2 BL:SWS:REP 58->97|TRXM_SPIOL|2e-04|35.0|40/181| BL:SWS:REP 68->170|CYCY_BRAJA|6e-28|44.7|103/194| PROS 68->86|PS00194|THIOREDOXIN_1|PDOC00172| TM:NTM 2 TM:REGION 6->28| TM:REGION 59->79| SEG 5->21|fslfvvviflsfcfvif| BL:PDB:NREP 2 BL:PDB:REP 58->97|1fb0B|7e-05|35.0|40/104| BL:PDB:REP 68->170|1kngA|2e-28|44.7|103/144| RP:PDB:NREP 1 RP:PDB:REP 32->173|2b1kA|2e-21|35.3|139/149| RP:PFM:NREP 1 RP:PFM:REP 68->159|PF08534|7e-20|44.0|91/132|Redoxin| HM:PFM:NREP 1 HM:PFM:REP 40->162|PF08534|2.9e-18|18.5|119/146|Redoxin| GO:PFM:NREP 1 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08534|IPR013740| RP:SCP:NREP 1 RP:SCP:REP 67->167|1z5yE1|4e-35|45.0|100/136|c.47.1.10| HM:SCP:REP 42->168|1z5yE1|4.3e-28|35.8|123/0|c.47.1.10|1/1|Thioredoxin-like| OP:NHOMO 501 OP:NHOMOORG 397 OP:PATTERN -------------------------------------------------------------------- ---11---------------------------1--1-----111---1------------113-------1---------------------------------------------------------------1-111-1---12-------------------------------------1112311-12-1111112111131211133--113221--11------1-1-----------------------------------------------------------------------------------------1---2-----------1--------1-----1-------1------1---11-111111211111111111111111111111111-11112111112-111112111111111124111111112111111111111111111111111---------------------211111-22-2111111---------------11111221211-11-11-1-2--221-1---1-------1211111--------------1-1111--1----1------------------------------22-221212211111111111111111111---122-------11--1-11111111111-111111111111111111111111---2222222222222222111111111-111111111111---1-----1111211-2222222222222112-------1211211111111122211111----------2222111112222211222222231111-11----------------1--------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 87.9 SQ:SECSTR #####################EEcccEEccccTTTTccccccccEEEEcccTTcEEEGGGGcccccEEEEEEcTTcHHHHHHHHHHHHHHHTTTccEEEEEEcccHHHHHHHHHHHcccccEEEEETTcHHHHHHTcccccEEEEEcTTccEEEEEEccccHHHHHTTHHHHH DISOP:02AL 173-174| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEccccccEEcHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHccccccEEEEcccHHHHHHHccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHc //