[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : cgtA
DDBJ      :cgtA         GTP-binding protein
Swiss-Prot:OBG_PELUB    RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg;

Homologs  Archaea  65/68 : Bacteria  910/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
b.117.1c.37.1
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->279 1lnzA PDBj 2e-59 49.6 %
:RPS:PDB   45->279 2bnxA PDBj 3e-24 10.4 %
:RPS:SCOP  3->157 1lnzA1  b.117.1.1 * 3e-54 40.0 %
:RPS:SCOP  161->273 1wxqA1  c.37.1.8 * 3e-17 24.0 %
:HMM:SCOP  2->158 1lnzA1 b.117.1.1 * 5.2e-56 54.1 %
:HMM:SCOP  150->326 1ni3A1 c.37.1.8 * 4.5e-50 41.4 %
:RPS:PFM   3->157 PF01018 * GTP1_OBG 8e-43 51.0 %
:RPS:PFM   171->279 PF01926 * MMR_HSR1 1e-15 47.0 %
:HMM:PFM   3->158 PF01018 * GTP1_OBG 1e-64 53.2 156/156  
:HMM:PFM   171->280 PF01926 * MMR_HSR1 1.4e-27 39.0 105/108  
:HMM:PFM   271->324 PF02421 * FeoB_N 0.00088 22.2 54/189  
:BLT:SWISS 1->327 OBG_PELUB e-170 100.0 %
:PROS 212->225|PS00905|GTP1_OBG
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21043.1 GT:GENE cgtA GT:PRODUCT GTP-binding protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 221539..222522 GB:FROM 221539 GB:TO 222522 GB:DIRECTION + GB:GENE cgtA GB:PRODUCT GTP-binding protein GB:PROTEIN_ID AAZ21043.1 GB:DB_XREF GI:71062040 GB:GENE:GENE cgtA LENGTH 327 SQ:AASEQ MKFLDQVKIYVKAGNGGHGSPSFRREKFIEYGGPDGGDGGKGGTIYLRSERNLNTLIDYRFQQHHKAGRGVNGSGQNRTGHSGEDLILKVPIGTQVFEEDNKTLIYDFKKEGEEFIVANGGKGGLGNTRFKSSTNRAPKKFTKGAPGEEYVIWLQLKTIADVGIVGLPNAGKSSLLASITNAMPKIANYKFTTLNPNLGVASYDDKEITLADIPGLVEGAHEGVGLGIQFLKHIERCKTLMHLIDITDEDLENTYKQVRNELGSYSKDLLEKKEIIVLNKTDLLEEEEVKEILKNFSKNKDSEVVTLSTLEKGSISRIKAKLLSYVS GT:EXON 1|1-327:0| SW:ID OBG_PELUB SW:DE RecName: Full=GTPase obg;AltName: Full=GTP-binding protein obg; SW:GN Name=obg; OrderedLocusNames=SAR11_0222; SW:KW Complete proteome; Cytoplasm; GTP-binding; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->327|OBG_PELUB|e-170|100.0|327/327| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| PROS 212->225|PS00905|GTP1_OBG|PDOC00704| SEG 32->43|ggpdggdggkgg| SEG 280->294|ktdlleeeevkeilk| BL:PDB:NREP 1 BL:PDB:REP 3->279|1lnzA|2e-59|49.6|272/332| RP:PDB:NREP 1 RP:PDB:REP 45->279|2bnxA|3e-24|10.4|230/337| RP:PFM:NREP 2 RP:PFM:REP 3->157|PF01018|8e-43|51.0|155/156|GTP1_OBG| RP:PFM:REP 171->279|PF01926|1e-15|47.0|100/105|MMR_HSR1| HM:PFM:NREP 3 HM:PFM:REP 3->158|PF01018|1e-64|53.2|156/156|GTP1_OBG| HM:PFM:REP 171->280|PF01926|1.4e-27|39.0|105/108|MMR_HSR1| HM:PFM:REP 271->324|PF02421|0.00088|22.2|54/189|FeoB_N| GO:PFM:NREP 3 GO:PFM GO:0005525|"GO:GTP binding"|PF01018|IPR006169| GO:PFM GO:0005525|"GO:GTP binding"|PF01926|IPR002917| GO:PFM GO:0005622|"GO:intracellular"|PF01926|IPR002917| RP:SCP:NREP 2 RP:SCP:REP 3->157|1lnzA1|3e-54|40.0|155/157|b.117.1.1| RP:SCP:REP 161->273|1wxqA1|3e-17|24.0|104/273|c.37.1.8| HM:SCP:REP 2->158|1lnzA1|5.2e-56|54.1|157/157|b.117.1.1|1/1|Obg GTP-binding protein N-terminal domain| HM:SCP:REP 150->326|1ni3A1|4.5e-50|41.4|174/296|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2819 OP:NHOMOORG 1170 OP:PATTERN 111-111111111111111111133113133221121212111122-21222212222222133-121 2111222222222222222-22222222222222222222222223222222222222222222222222222222222222222222222222222112222222221222222222222222222222222222111111111122212222222111111222222212111222121122222211222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222212222222222222222222222222222222222222222122122123212222122212222122222222222222222222222222222-22122222222222222222222222211222222222211111111122212223322222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222212122222222222222222222113122112222222222222222222222222222222222222223333333322323223332-2212122222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222122222222222222222222222222222222222222222-22222222222222222221111122222222 4433556-E5524533332344433334444343333444444432534444423334434444344442423433434443333333-33333233222-12454358678766543332453A6285Hd6-7883242425734343273362554647755553744425665668y8875776AB37A6655234 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 325 STR:RPRED 99.4 SQ:SECSTR ##EEEEEEHHHHHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHTccTTTccTTHHHHHHHHHHHHHHHTccHHHHHHHHHcccHHHHHHHTccTTcHHHHHHHHHHHHHHHTccccTTHHHHHHHHHHHHHHHHTccTTHHHHHHTcTTccHHHHHHHHHHHHHHHTTccTccHcHHHHHHHHHHHHHTTHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHccTTTccHHHHHHHHHHHHHTTcccEEccTTTTcTHHHHHHHHHHHHT DISOP:02AL 67-78, 133-156| PSIPRED ccEEEEEEEEEEEcccccccEEEHHcccccccccccccccccEEEEEEEcccHHHHHHcccccEEEccccccccccccccccccEEEEEccccEEEEEccccEEEEEEEccccEEEEEcccccccccHHHHHHHHcccHHHccccccccEEEEEEccccccEEEEEcccccHHHHHHHHHcccccEEcccccccccEEEEEEEcccEEEEEEcccccccccHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHHHHHHcHHHHcccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHc //