[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : cinA
DDBJ      :cinA         competence/damage-inducible protein CinA
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  616/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.51.5
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   27->162 2a9sB PDBj 5e-21 37.5 %
:RPS:PDB   27->163 2a9sB PDBj 6e-34 37.2 %
:RPS:SCOP  27->162 2a9sA1  c.51.5.1 * 3e-35 37.5 %
:HMM:SCOP  1->165 2a9sA1 c.51.5.1 * 6.6e-46 39.4 %
:RPS:PFM   29->163 PF02464 * CinA 6e-26 43.3 %
:HMM:PFM   12->161 PF02464 * CinA 1.1e-56 40.9 149/155  
:BLT:SWISS 29->159 CINA_THETN 1e-26 43.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21755.1 GT:GENE cinA GT:PRODUCT competence/damage-inducible protein CinA GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(928018..928509) GB:FROM 928018 GB:TO 928509 GB:DIRECTION - GB:GENE cinA GB:PRODUCT competence/damage-inducible protein CinA GB:PROTEIN_ID AAZ21755.1 GB:DB_XREF GI:71062752 GB:GENE:GENE cinA LENGTH 163 SQ:AASEQ MFHDFKELYFIMKNIVKKLIKKKLKISFAESCTGGLLAASITSISGASKVFNIGLITYSNQAKINILKVNKNIIKKYGAVSAECCEAMVKNLTKISKAQINVSVTGIAGPNGATKNKPIGLVYIGVKRSNKLVITKNIFKQKTRSSIQKASVKRALDIVSSLI GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 29->159|CINA_THETN|1e-26|43.1|130/412| SEG 17->26|kklikkklki| SEG 63->76|kinilkvnkniikk| BL:PDB:NREP 1 BL:PDB:REP 27->162|2a9sB|5e-21|37.5|136/165| RP:PDB:NREP 1 RP:PDB:REP 27->163|2a9sB|6e-34|37.2|137/165| RP:PFM:NREP 1 RP:PFM:REP 29->163|PF02464|6e-26|43.3|134/155|CinA| HM:PFM:NREP 1 HM:PFM:REP 12->161|PF02464|1.1e-56|40.9|149/155|CinA| RP:SCP:NREP 1 RP:SCP:REP 27->162|2a9sA1|3e-35|37.5|136/167|c.51.5.1| HM:SCP:REP 1->165|2a9sA1|6.6e-46|39.4|165/0|c.51.5.1|1/1|CinA-like| OP:NHOMO 626 OP:NHOMOORG 621 OP:PATTERN ------------------------1------1------------------------------------ 111-1-1-111-1-1----------1---------------------1---------1--1111---1-11-------111-1111111111-111---1--1-1111-1---------------11-111-1111-----1111-111111111--11-11-1-111111-111111-1111-----11--11111111111111111-11111111111111111111111--------------------1-1----1---1111----1-------1111111111111111111111111111111111--111---111111111111111111111111111--11-1111111111111111-1--1-2112-111111----111-11-11111111111-11111111111-1111111111111111111-1111111111111111--1111111111111--11-----------------1111111----1111111111111111111111111111-11111-111-1111111-111-1-1-11111111111-11111111-1111-11111111111-12--11111111111111111111111111----111111-111111111111111111111---1111------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---111111111111111-------------------------1111111111111111-1----------11111-------1----1111111111111-11111111--------1-1----1---1---1----1-1--11111111111111-1 ---------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------2----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 84.0 SQ:SECSTR ##########################EEEEEccTTHHHHHHTTcTTGGGTEEEEEEcccHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHTccccEEEEEEEccccccccccccTTEEEEEEEETTccEEEEEEEccccHHHHHHHHHHHHHHHHHHHH DISOP:02AL 162-164| PSIPRED cccccccHHHHHHHHHHHHHHcccEEEEHHHHcHHHHHHHHHccccHHHHHcccEEEEcHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccEEEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHc //