[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : copZ
DDBJ      :copZ         probable heavy metal transport/detoxification protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   22->88 3dxsX PDBj 2e-05 27.3 %
:RPS:SCOP  21->97 1jwwA  d.58.17.1 * 8e-06 21.1 %
:HMM:SCOP  22->89 1sb6A_ d.58.17.1 * 7e-07 29.7 %
:HMM:PFM   27->62 PF00403 * HMA 0.00025 33.3 36/62  
:HMM:PFM   69->88 PF09285 * Elong-fact-P_C 0.0003 45.0 20/56  
:BLT:SWISS 23->90 ATCU2_RHIME 9e-04 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20876.1 GT:GENE copZ GT:PRODUCT probable heavy metal transport/detoxification protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(64574..64903) GB:FROM 64574 GB:TO 64903 GB:DIRECTION - GB:GENE copZ GB:PRODUCT probable heavy metal transport/detoxification protein GB:PROTEIN_ID AAZ20876.1 GB:DB_XREF GI:71061873 GB:GENE:GENE copZ LENGTH 109 SQ:AASEQ MFKKYILFLGFVLFSTNLFAAQTQIAQVNGMMCIKCQKMVTKALQAASPSATVKVSWPEGVAVSSYPDKSDLSNEDYKKAILGTGFEVIKVVSVDKIITDAGEARKLVD GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 23->90|ATCU2_RHIME|9e-04|36.4|66/100| RP:PDB:NREP 1 RP:PDB:REP 22->88|3dxsX|2e-05|27.3|66/74| HM:PFM:NREP 2 HM:PFM:REP 27->62|PF00403|0.00025|33.3|36/62|HMA| HM:PFM:REP 69->88|PF09285|0.0003|45.0|20/56|Elong-fact-P_C| RP:SCP:NREP 1 RP:SCP:REP 21->97|1jwwA|8e-06|21.1|76/80|d.58.17.1| HM:SCP:REP 22->89|1sb6A_|7e-07|29.7|64/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 69.7 SQ:SECSTR ###################ccEEEEEEEEccccHHHHHHHHHHHHTcTTEEEEEEEGGGTEEEEEE#cTTTccHHHHHHHHHHHTcEEEEEEcccc############# DISOP:02AL 108-109| PSIPRED cHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEEccHHHccHHHHHHHHHHccHHHHHHHHHHHHHHccccHHcccc //