[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : coq7
DDBJ      :coq7         Coq7 family protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  116/199 : Viruses  0/175   --->[See Alignment]
a.25.1
:177 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  3->158 1vjxA_ a.25.1.1 * 4.8e-14 24.3 %
:RPS:PFM   13->177 PF03232 * COQ7 1e-24 36.6 %
:HMM:PFM   8->177 PF03232 * COQ7 3.2e-67 54.5 167/172  
:BLT:SWISS 9->177 COQ7_CAEEL 9e-22 36.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21241.1 GT:GENE coq7 GT:PRODUCT Coq7 family protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(406848..407381) GB:FROM 406848 GB:TO 407381 GB:DIRECTION - GB:GENE coq7 GB:PRODUCT Coq7 family protein GB:PROTEIN_ID AAZ21241.1 GB:DB_XREF GI:71062238 GB:GENE:GENE coq7 LENGTH 177 SQ:AASEQ MKKTNKEKVKEFIRVDHAGERGAIKIYEGQLLALNTFVKDENLKKKIEEMKIHEKEHCEYFENEIKKRNIKPTKFLPLWDLLGVGLGFGSTMLGKKAAMLCTASVEEVIDEHYLNQINELENDEKKLKEKIIKFREDELHHKDIAYKEGATKKGMYSILDKLIKTGSKIAINISEKI GT:EXON 1|1-177:0| BL:SWS:NREP 1 BL:SWS:REP 9->177|COQ7_CAEEL|9e-22|36.4|165/187| SEG 44->59|kkkieemkihekehce| SEG 117->133|inelendekklkekiik| RP:PFM:NREP 1 RP:PFM:REP 13->177|PF03232|1e-24|36.6|161/167|COQ7| HM:PFM:NREP 1 HM:PFM:REP 8->177|PF03232|3.2e-67|54.5|167/172|COQ7| HM:SCP:REP 3->158|1vjxA_|4.8e-14|24.3|144/0|a.25.1.1|1/1|Ferritin-like| OP:NHOMO 180 OP:NHOMOORG 161 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111----------------------------------------1---------------1-1------------------1---11-1111111111111111111111111111111-1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11------111-1---1111-11--11-11--------------111111-1111111-11111111-11111-11-111111--1-1111111-11--21----12321111111----11-3-171-111-11-1--21-1-1-11-11111121111111123111111-----------1-1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcc //