[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : cox1
DDBJ      :cox1         cytochrome-c oxidase
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  603/915 : Eukaryota  62/199 : Viruses  0/175   --->[See Alignment]
f.24.1
:544 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->537 1qleA PDBj 0.0 62.3 %
:RPS:PDB   14->527 3dtuA PDBj 5e-89 39.2 %
:RPS:SCOP  17->528 1ar1A  f.24.1.1 * e-122 57.4 %
:HMM:SCOP  15->536 1ocrA_ f.24.1.1 * 6.5e-227 63.7 %
:RPS:PFM   31->464 PF00115 * COX1 e-128 62.0 %
:HMM:PFM   26->480 PF00115 * COX1 8e-178 53.6 442/447  
:BLT:SWISS 14->534 COX1_BRAJA 0.0 73.6 %
:PROS 257->311|PS00077|COX1_CUB
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20958.1 GT:GENE cox1 GT:PRODUCT cytochrome-c oxidase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(141011..142645) GB:FROM 141011 GB:TO 142645 GB:DIRECTION - GB:GENE cox1 GB:PRODUCT cytochrome-c oxidase GB:NOTE chain I GB:PROTEIN_ID AAZ20958.1 GB:DB_XREF GI:71061955 GB:GENE:GENE cox1 LENGTH 544 SQ:AASEQ MYTKTASHDDHHTPTGWKRWAYSTNHKDIGTMYLIFAIVAGIIGTAFSVLMRIELMHPGDGILGGNYHLYNVLVTGHGLIMIFFMVMPAMIGGFGNWFVPIMIGAPDMAFPRMNNISFWLLPASFILLLLSIFVDGPPGQQGVGGGWTLYPPLSSKAGQPGPAMDFAILSLHLAGASSILGAVNFITTILNMRTPGMTLHKMPLFAWSVLVTAFLLLLSLPVLAGAITMLLTDRNFGTAFFDAQTGGDPVLYQHLFWFFGHPEVYILILPGFGMISHIVSTFSKKPVFGYLGMAYAMVSIGVVGFVVWAHHMYTVGLSTDTKAYFLAATMIIAVPTGIKIFSWIATMWGGSISFKTPMMWALGFIFLFTVGGVTGVVLANAGVDTAMHDTYYVVAHFHYVLSLGAVFAIFAGFYYWFGKMSGYEYSEWMGQLHFWLTFIGVNLVFFPQHFLGLAGMPRRYADYPDAFAGWNYVSSIGSYIAVAGLLVFFANLIYSFSKKKAAAQNPWGEGATTLEWTVPSPPNFHTFEELPKFEDPDGAEKVSS GT:EXON 1|1-544:0| BL:SWS:NREP 1 BL:SWS:REP 14->534|COX1_BRAJA|0.0|73.6|519/541| PROS 257->311|PS00077|COX1_CUB|PDOC00074| TM:NTM 12 TM:REGION 33->55| TM:REGION 81->103| TM:REGION 116->138| TM:REGION 166->188| TM:REGION 207->229| TM:REGION 261->283| TM:REGION 288->310| TM:REGION 325->347| TM:REGION 363->385| TM:REGION 394->416| TM:REGION 429->451| TM:REGION 475->497| SEG 120->133|llpasfillllsif| SEG 136->146|gppgqqgvggg| SEG 209->226|vlvtafllllslpvlaga| SEG 362->383|lgfiflftvggvtgvvlanagv| BL:PDB:NREP 1 BL:PDB:REP 19->537|1qleA|0.0|62.3|517/538| RP:PDB:NREP 1 RP:PDB:REP 14->527|3dtuA|5e-89|39.2|510/539| RP:PFM:NREP 1 RP:PFM:REP 31->464|PF00115|e-128|62.0|421/423|COX1| HM:PFM:NREP 1 HM:PFM:REP 26->480|PF00115|8e-178|53.6|442/447|COX1| GO:PFM:NREP 5 GO:PFM GO:0005506|"GO:iron ion binding"|PF00115|IPR000883| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00115|IPR000883| GO:PFM GO:0009060|"GO:aerobic respiration"|PF00115|IPR000883| GO:PFM GO:0016021|"GO:integral to membrane"|PF00115|IPR000883| GO:PFM GO:0020037|"GO:heme binding"|PF00115|IPR000883| RP:SCP:NREP 1 RP:SCP:REP 17->528|1ar1A|e-122|57.4|507/529|f.24.1.1| HM:SCP:REP 15->536|1ocrA_|6.5e-227|63.7|513/514|f.24.1.1|1/1|Cytochrome c oxidase subunit I-like| OP:NHOMO 1227 OP:NHOMOORG 691 OP:PATTERN 22----4333333336-11-1---31131111-----------------------------1----11 1242111111111131111-151121111112322325342342111111111111111122213222223------------1-----------------111111111--------------11----------21111---11132211111112122222212534211111111211211111---22222222222222222222222222212242111111114221111111111111111111--------------------------------------------------------------------------------------------------1---------------------1-21223111111253364112232112212222221355436344421322254335454211112133333121111111112331212-111111111111111111111111-111111112-1443543333432333444766664445546551144422322212151321121121-------1233211-----11-1-111-1-1-1111-222222---------------------------2211131111221112221212222211321211-31-111111111111111111111111-1111111111111111111111111111111111111111111111----111111111111111112111111121122111---------------1111111---2122222322222222111-11111111----2-----221113322222222111111--111111----------------------------------------------22- -2------1-----1------------112-12111-------122-1------111-----6-311---1-1---6-1--------------1--111------2------11111-----1-1--1-14--11-----1--21--------1-1--1----2-112--l-15-1-1-------1--4--1--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 524 STR:RPRED 96.3 SQ:SECSTR #############ccHHHHHTTcccHHHcccccccccGGGGcccHHHHHHHHTccccGGGcGccccHHHHHHHHHHHHHHHHHHTHHHHHTTTHHHHHHHHHHTccccccHHHHHHHHHHHHHHHHHHHHHTTcccGGGccccccTTTTcTTHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTccGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccTTcGGGTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccTTHHHHHHHHHHHHHHTTccGGGGcTTccccHHHHHHHHHHHHHTHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHTTcHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccccccGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccTTcccGGGGcccccccccccccccHHHHc####### DISOP:02AL 1-10| PSIPRED ccccccccccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHccccccEEEEccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccEEEcHHHHHHHcc //