[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : coxB
DDBJ      :coxB         probable cytochrome c oxidase polypeptide II (Cytochrome aa3 subunit 2)
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  383/915 : Eukaryota  64/199 : Viruses  0/175   --->[See Alignment]
b.6.1f.17.2
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->252 1m56B PDBj 3e-60 51.9 %
:RPS:PDB   17->250 3dtuB PDBj 9e-50 38.6 %
:RPS:SCOP  21->117 1ar1B2  f.17.2.1 * 8e-23 33.3 %
:RPS:SCOP  118->252 1ar1B1  b.6.1.2 * 1e-31 48.1 %
:HMM:SCOP  10->117 1ar1B2 f.17.2.1 * 9.5e-29 38.3 %
:HMM:SCOP  117->258 1m56B1 b.6.1.2 * 4.7e-58 53.5 %
:RPS:PFM   25->109 PF02790 * COX2_TM 2e-11 39.2 %
:RPS:PFM   121->238 PF00116 * COX2 7e-37 52.5 %
:HMM:PFM   121->239 PF00116 * COX2 7.8e-51 57.1 119/120  
:HMM:PFM   22->109 PF02790 * COX2_TM 1.4e-24 30.5 82/84  
:BLT:SWISS 18->270 COX2_RICBR 3e-61 49.4 %
:PROS 184->232|PS00078|COX2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20959.1 GT:GENE coxB GT:PRODUCT probable cytochrome c oxidase polypeptide II (Cytochrome aa3 subunit 2) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(142648..143463) GB:FROM 142648 GB:TO 143463 GB:DIRECTION - GB:GENE coxB GB:PRODUCT probable cytochrome c oxidase polypeptide II (Cytochrome aa3 subunit 2) GB:PROTEIN_ID AAZ20959.1 GB:DB_XREF GI:71061956 GB:GENE:GENE coxB LENGTH 271 SQ:AASEQ MKKFLITIITTMLITSAWADQPKNWQLGFQDSASQSMTEIVSFHNNILLPVIIAISVFVLFLMIYVCIRFRASKNPNPSKTTHNVAVEVLWTLIPCLILIVMAVPSFKILYKQDTIPKADLTIKAVGYQWYWGYEYPDENIIFESYMIKEAELKENQPRLLTVDNEVIVPVNKVVKVLITANDVLHAWALPSFGVKRDAVPGRINETWFKAEKVGTYYGQCSELCGIEHAFMPITVKVVTDEEYAIWLAEAKMKFAKEPIAENEYKKLASK GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 18->270|COX2_RICBR|3e-61|49.4|247/269| PROS 184->232|PS00078|COX2|PDOC00075| TM:NTM 3 TM:REGION 4->21| TM:REGION 46->68| TM:REGION 86->108| SEG 5->15|litiittmlit| SEG 163->177|vdnevivpvnkvvkv| BL:PDB:NREP 1 BL:PDB:REP 21->252|1m56B|3e-60|51.9|231/260| RP:PDB:NREP 1 RP:PDB:REP 17->250|3dtuB|9e-50|38.6|233/259| RP:PFM:NREP 2 RP:PFM:REP 25->109|PF02790|2e-11|39.2|79/82|COX2_TM| RP:PFM:REP 121->238|PF00116|7e-37|52.5|118/119|COX2| HM:PFM:NREP 2 HM:PFM:REP 121->239|PF00116|7.8e-51|57.1|119/120|COX2| HM:PFM:REP 22->109|PF02790|1.4e-24|30.5|82/84|COX2_TM| GO:PFM:NREP 8 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF02790|IPR011759| GO:PFM GO:0005507|"GO:copper ion binding"|PF02790|IPR011759| GO:PFM GO:0009055|"GO:electron carrier activity"|PF02790|IPR011759| GO:PFM GO:0016021|"GO:integral to membrane"|PF02790|IPR011759| GO:PFM GO:0022900|"GO:electron transport chain"|PF02790|IPR011759| GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| RP:SCP:NREP 2 RP:SCP:REP 21->117|1ar1B2|8e-23|33.3|96/107|f.17.2.1| RP:SCP:REP 118->252|1ar1B1|1e-31|48.1|135/145|b.6.1.2| HM:SCP:REP 10->117|1ar1B2|9.5e-29|38.3|107/107|f.17.2.1|1/1|Cytochrome c oxidase subunit II-like, transmembrane region| HM:SCP:REP 117->258|1m56B1|4.7e-58|53.5|142/0|b.6.1.2|1/1|Cupredoxins| OP:NHOMO 606 OP:NHOMOORG 461 OP:PATTERN 11-----1-11---1---1-1---311111-------------------------------------- 11311-----------------------------------1111-11111111111111111111-11111------------1-----------------------111--------------11----------111-1---11122211-1111-----12-113321-------------1-11-----12222222222222221122212211112111-----1111--------------1--1---------------------------------------------------------------------------------------------------1---------------------1-21112-----12211331121221111111-111122432423331-211133224343111112112222111--------111-112-111111111111111111111111-111111111-1111222222221111222322222112412111122211111112141211111111-------1132111-----11---111-1-1-1111-121122--------------------------------211111111111111111111111111---31-1--------------------------------------------------------------------------------------------1111111111111---------------------------2111111111211112----------------2-----111112211111111111111--111111-----------------------------------------------2- 11------1-----1--1---------111-11111-------111-1------121-1---1-111---1-----1----------------1---11-1--111------11111-----1-11-1-16--11-----1--11--------1-1-------2--12--1-12-122----1--1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 93.7 SQ:SECSTR ###############ccEEEcccTTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcTTTccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEETTEEEEEETTTTEEEEEccTTcGGGTccccccHHHHHHHHHTTccGGGTTEEEccccEEEEEGGGTEEEEEccTccEEEEEEccccEEEEEcccccccTTGGGccEEEEEEcHHHHHHHHHHHcHTcccccccHHHHHHHH## DISOP:02AL 251-265, 269-271| PSIPRED cHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEEEEccccEEEEEEcccHHHccccccEEEEEcccEEEcccccEEEEEEccHHHHHHHHHHHcccccccccHHHHHHHHHccccccEEccHHHHccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //