[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : coxW
DDBJ      :coxW         cytochrome c oxidase assembly protein (isoform 1)
Swiss-Prot:CTAA_PELUB   RecName: Full=Heme A synthase;         Short=HAS;         EC=1.3.-.-;AltName: Full=Cytochrome aa3-controlling protein;

Homologs  Archaea  0/68 : Bacteria  125/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
:336 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->325 PF02628 * COX15-CtaA 2e-17 32.4 %
:HMM:PFM   14->326 PF02628 * COX15-CtaA 2.2e-85 39.2 291/301  
:BLT:SWISS 1->336 CTAA_PELUB e-159 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21837.1 GT:GENE coxW GT:PRODUCT cytochrome c oxidase assembly protein (isoform 1) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1007212..1008222) GB:FROM 1007212 GB:TO 1008222 GB:DIRECTION - GB:GENE coxW GB:PRODUCT cytochrome c oxidase assembly protein (isoform 1) GB:NOTE similar to BA483f11.2.1 cox15 (yeast) GB:PROTEIN_ID AAZ21837.1 GB:DB_XREF GI:71062834 GB:GENE:GENE coxW LENGTH 336 SQ:AASEQ MFVNSDNYIKYLKLWLITLFSLIVLMVAVGGLTRLTDSGLSITAWELFTGILPPMNINEWNFYFTEYKKIPEYKNINYGMSLDEFKVIFYWEYAHRLLARFVGLFTLVPLLFFTLYFKKTLHYSNKYYWIFFLVCLQGFIGWYMVSSGLIENNDVSHFRLSIHLSLALFILCLIFWYILDIHKIKKFENKIPNLFLLFILKLIVLQIVLGAFLSGLDGGLIYNSWPDMNGSFFPNDVSYGDLITTQLFNNPSIIQFLHRSTAYLLLFFIIILNFIYFKKQYDFKYVLFFDVAILFQIFLGIITLISGVEITYASLHQLGSILVLSSYFLILYKNSN GT:EXON 1|1-336:0| SW:ID CTAA_PELUB SW:DE RecName: Full=Heme A synthase; Short=HAS; EC=1.3.-.-;AltName: Full=Cytochrome aa3-controlling protein; SW:GN Name=ctaA; Synonyms=coxW; OrderedLocusNames=SAR11_1031; SW:KW Cell membrane; Complete proteome; Heme biosynthesis; Membrane;Oxidoreductase; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->336|CTAA_PELUB|e-159|100.0|336/336| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006783|"GO:heme biosynthetic process"|Heme biosynthesis| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 8 TM:REGION 7->29| TM:REGION 96->117| TM:REGION 125->147| TM:REGION 159->181| TM:REGION 194->216| TM:REGION 256->277| TM:REGION 287->309| TM:REGION 313->335| SEG 101->121|fvglftlvpllfftlyfkktl| SEG 189->209|nkipnlfllfilklivlqivl| SEG 263->277|ylllffiiilnfiyf| RP:PFM:NREP 1 RP:PFM:REP 12->325|PF02628|2e-17|32.4|272/283|COX15-CtaA| HM:PFM:NREP 1 HM:PFM:REP 14->326|PF02628|2.2e-85|39.2|291/301|COX15-CtaA| GO:PFM:NREP 2 GO:PFM GO:0006461|"GO:protein complex assembly"|PF02628|IPR003780| GO:PFM GO:0016020|"GO:membrane"|PF02628|IPR003780| OP:NHOMO 336 OP:NHOMOORG 306 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------11--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111-11111111111111111111111111111111111111-111-111111111111111111111111-111111111----------------------------------------------------1-------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11--111-311-11111111111111111111111111-11111111111111111111111111111111111111-1111111111-11111111111121211-1112131131111-11121121272-212-1-1111-11121-1111-121111-11111111-1111-11161111111211111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 3-5| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccEEEEccccHHHHHHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //