[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : crtI
DDBJ      :crtI         phytoene dehydrogenase
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  177/915 : Eukaryota  44/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:485 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->117 1reoA PDBj 4e-05 24.8 %
:RPS:PDB   2->479 3bi2A PDBj 8e-42 12.3 %
:RPS:SCOP  1->24,178->355 1sezA1  c.3.1.2 * 3e-19 12.8 %
:RPS:SCOP  1->101 2ivdA1  c.3.1.2 * 4e-18 23.2 %
:HMM:SCOP  1->481 1o5wA1 c.3.1.2 * 2e-46 26.6 %
:RPS:PFM   12->60 PF01593 * Amino_oxidase 3e-10 51.0 %
:HMM:PFM   11->479 PF01593 * Amino_oxidase 3.5e-20 16.8 416/449  
:BLT:SWISS 2->39 MNMC_BURA4 8e-04 42.1 %
:BLT:SWISS 17->479 CRTI_PANAN e-102 40.2 %
:PROS 457->477|PS00982|PHYTOENE_DH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20944.1 GT:GENE crtI GT:PRODUCT phytoene dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 129473..130930 GB:FROM 129473 GB:TO 130930 GB:DIRECTION + GB:GENE crtI GB:PRODUCT phytoene dehydrogenase GB:PROTEIN_ID AAZ20944.1 GB:DB_XREF GI:71061941 GB:GENE:GENE crtI LENGTH 485 SQ:AASEQ MKSIVIGSGFGGIAAALRLRAKNHKVTLIEKHPDLGGRARVFKKNGFTFDAGPTVITAPYLIEELFTLFNKKSQDYIKLTPLKTWYRFIYEDGGVFDYSGNEDQMKKQIEKINKEDVKGYEQLVKFTKKIFDKGFTELADVPFDKPLVMMKQLPSLLKLKSYKSVYSLVSSYIKNEKLRRMLSMHPLLVGGNPFTTTSIYGLILYLEKKWGIHYSMGGTGNIINGLEKLMIEQEIEVIKGHEVTKIISDNGKISGVKLDNQKEMLSNNVICNADPPAVYEKLLSLNKTSPLFKWKQNRMQYSMGLFVYYFGTKKTYPDVEHHTIKFGDKYKEHLSDIFDNKKLNDDISYYLHRPSATDKSMAPEGNDCFYVLVPVPNNQSKIDWKIEGEKMKNLVIDKMEKALLPNLRENIIEDFYLTPDYFENELNTKFGSGFSIQPKFTQSAYFRFHNKSEIYDGLYFVGAGTHPGAGVPGVLSSAKVLDKIL GT:EXON 1|1-485:0| BL:SWS:NREP 2 BL:SWS:REP 2->39|MNMC_BURA4|8e-04|42.1|38/652| BL:SWS:REP 17->479|CRTI_PANAN|e-102|40.2|463/492| PROS 457->477|PS00982|PHYTOENE_DH|PDOC00755| SEG 155->172|sllklksyksvyslvssy| BL:PDB:NREP 1 BL:PDB:REP 4->117|1reoA|4e-05|24.8|113/484| RP:PDB:NREP 1 RP:PDB:REP 2->479|3bi2A|8e-42|12.3|447/494| RP:PFM:NREP 1 RP:PFM:REP 12->60|PF01593|3e-10|51.0|49/426|Amino_oxidase| HM:PFM:NREP 1 HM:PFM:REP 11->479|PF01593|3.5e-20|16.8|416/449|Amino_oxidase| RP:SCP:NREP 2 RP:SCP:REP 1->24,178->355|1sezA1|3e-19|12.8|196/353|c.3.1.2| RP:SCP:REP 1->101|2ivdA1|4e-18|23.2|99/341|c.3.1.2| HM:SCP:REP 1->481|1o5wA1|2e-46|26.6|297/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 335 OP:NHOMOORG 242 OP:PATTERN ------11-1111111---1----22222212--1-----------1--------------1------ 2--1-111111111-11----1--11------11111111-111211111111--11---111-2111131---------1-1----------------1-11111-121---------------11--11---2243333---21-21-221-1--------1--1111---111111-1--11111---13-----------------1--2--------244111111---22222222222222---2------------11-------11------------------------------------------------------------1-1-----11---------1-------21---------1-21---------1-21---22221------------33333-33-----------------1---12-11112----------------21-----------------------------111-1------------------------------------------------------------------------1---------------------------41------------1---------------------------------------------------1--------1-----------------------------------------1-------------------------------------------------------------------------------------------------1----------------------1---------------------1----------------1-------------------------------------- ---------------1111----111-------1-1----------11--111111---111------------------------------1------1111112---1------------------------------------------------------1------------1181111-3--21-111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 485 STR:RPRED 100.0 SQ:SECSTR cEEEEEcccHHHHHHHHHHHTTcccEEEEcccccccTTccEEEGGGcEEEccccEEccTTTcHHHHHHHHHHHHHcccccEEcccccEEccccccEEEETTTEEccccTTTcHHHHHHHHHHHHHHHHTTcTTcccccHHHHHHHHHHHHGGGccccHHHHHHHcccHHGGGGcHHHHHHHHHHGGGGHHHHTccTTTccHHHHcccccccccEEEcccHHHHHHHHTcccGGGEETEcTccEEEEEEETTTEEEEEETTccEEEEEEEEEcccHHHHGGGGcccEEEccccHHHHTccEEEccEEEEEEEccccccccccEEEEcccccHHHHHHHHHcccHHHHcccTTcccEEEEEHHHHTcccEEEEEEccTHHHHHHTTTTcHHHHHHHHHHHHHHHHHHHTTccccccEEEEEEEccTTTcTTTcccEEEccTTccHHHHHHHHHTcccccEEEccTTcccTTcHHHHHHHHHHHHHHH DISOP:02AL 484-486| PSIPRED cEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccEEEEEEEccEEEEEcccEEccccHHHHHHHHHHHHHHccccEEEccccEEEEcccccEEEEcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHHcccEEEEccEEEEEEEEccEEEEEEEccccEEEccEEEEEccHHHHHHHccccccccHHHHHHHHcccccccEEEEEcccccccccccccEEEEccccHHHHHHHHHccccccccEEEEEEccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEccHHHHHHHHccccccccccccccHHHHcccccccccccccEEEEcccccccccHHHHHHHHHHHHHHc //