[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : cspE
DDBJ      :cspE         cold shock protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  686/915 : Eukaryota  70/199 : Viruses  1/175   --->[See Alignment]
b.40.4
:70 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->69 1mjcA PDBj 3e-16 50.0 %
:RPS:PDB   6->68 3camA PDBj 3e-17 45.2 %
:RPS:SCOP  5->69 1c9oA  b.40.4.5 * 2e-17 46.9 %
:HMM:SCOP  3->70 1h95A_ b.40.4.5 * 6.4e-23 54.4 %
:RPS:PFM   6->66 PF00313 * CSD 2e-15 59.0 %
:HMM:PFM   4->68 PF00313 * CSD 3e-29 61.5 65/67  
:BLT:SWISS 1->66 CSPE_SHIFL 2e-19 59.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21299.1 GT:GENE cspE GT:PRODUCT cold shock protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 466720..466932 GB:FROM 466720 GB:TO 466932 GB:DIRECTION + GB:GENE cspE GB:PRODUCT cold shock protein GB:PROTEIN_ID AAZ21299.1 GB:DB_XREF GI:71062296 GB:GENE:GENE cspE LENGTH 70 SQ:AASEQ MSTLKGTVKWFNGKKGFGFIEREDKEKDAFVHASAVKTAGMRFLNEGDKLEFEMEDGPKGPSAVNLKKID GT:EXON 1|1-70:0| BL:SWS:NREP 1 BL:SWS:REP 1->66|CSPE_SHIFL|2e-19|59.1|66/69| BL:PDB:NREP 1 BL:PDB:REP 4->69|1mjcA|3e-16|50.0|66/69| RP:PDB:NREP 1 RP:PDB:REP 6->68|3camA|3e-17|45.2|62/65| RP:PFM:NREP 1 RP:PFM:REP 6->66|PF00313|2e-15|59.0|61/67|CSD| HM:PFM:NREP 1 HM:PFM:REP 4->68|PF00313|3e-29|61.5|65/67|CSD| GO:PFM:NREP 2 GO:PFM GO:0003677|"GO:DNA binding"|PF00313|IPR002059| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00313|IPR002059| RP:SCP:NREP 1 RP:SCP:REP 5->69|1c9oA|2e-17|46.9|64/66|b.40.4.5| HM:SCP:REP 3->70|1h95A_|6.4e-23|54.4|68/0|b.40.4.5|1/1|Nucleic acid-binding proteins| OP:NHOMO 2374 OP:NHOMOORG 763 OP:PATTERN ------------------------3--11--2----------------------------------11 553-611222211123311-142223111112333344532224322-1223354212--442-4368761--11---1-2-211122-----------1-114212232-----------------1-11113-1-----------1-----------------------------------12122--2123666666666666676213333667211436233333365-33333333333332222235-113311-1-4311334211112341111111--------------1111111111111-11111111312222222222211-1444211-5-1-2-11--11241--42111112112--33341111153B55B444444533233333232-55375445494-4443655776753321332565454333333333323333333------------1111111111111----22232154445666566533324467444434557586512444111--------3212323231111111224233-4526----------666334653555561551-------------------1---1114433464349B433333332332333333411-121311122245445737557755-66-568555577557755765645444556555544544455555575545555319747876576881122-----5554233352221222111111123422423334343553444434345333322222222224448444444444422222222221111115-----------------11-11----1--------1-------2311122212--- --11------------------1-------------------------------------------------------------------------------------4--3213122-111317A1715J3-51B-1-28--43123315-15-42-112228221-1--1121----5211123144-1221----- ---------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 95.7 SQ:SECSTR ###EEEEEEEEETTTTEEEEEETTccccEEEEGGGcccGGGccccTTccEEEEEEEETTEEEEEEEEEcT DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEccccEEEEEEcccccEEEEEEEEEccccccccccccEEEEEEEEcccccEEEEEEEcc //