[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : cvpA
DDBJ      :cvpA         Colicin V production protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   26->129 PF02674 * Colicin_V 5e-09 31.7 %
:HMM:PFM   15->158 PF02674 * Colicin_V 9.4e-30 25.9 143/146  
:BLT:SWISS 26->140 CVPA_HAEIN 3e-07 25.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21519.1 GT:GENE cvpA GT:PRODUCT Colicin V production protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(684353..684898) GB:FROM 684353 GB:TO 684898 GB:DIRECTION - GB:GENE cvpA GB:PRODUCT Colicin V production protein GB:PROTEIN_ID AAZ21519.1 GB:DB_XREF GI:71062516 GB:GENE:GENE cvpA LENGTH 181 SQ:AASEQ MLDALKDFYQAVSLIDLIFLIITIFSVIKCYSKGFVLSLLSASKWVLAYVVTLLLFPKAKPYFKNIIDSEYVLDIALGITIFILVIFVILITNKAISKTVKFVGLGRLDSLFGLFFGFIRSYVICICLFSAIDIVYNYSKWPINTDKSYAFPYIEKGSNYLLKEFPNEKNYQDSKEKIQDL GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 26->140|CVPA_HAEIN|3e-07|25.4|114/100| TM:NTM 4 TM:REGION 5->27| TM:REGION 36->58| TM:REGION 74->96| TM:REGION 113->135| SEG 14->25|lidlifliitif| SEG 79->92|itifilvifvilit| RP:PFM:NREP 1 RP:PFM:REP 26->129|PF02674|5e-09|31.7|104/145|Colicin_V| HM:PFM:NREP 1 HM:PFM:REP 15->158|PF02674|9.4e-30|25.9|143/146|Colicin_V| GO:PFM:NREP 2 GO:PFM GO:0009403|"GO:toxin biosynthetic process"|PF02674|IPR003825| GO:PFM GO:0016020|"GO:membrane"|PF02674|IPR003825| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 170-177, 179-181| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHcc //