[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : cysQ
DDBJ      :cysQ         cysQ protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  511/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
e.7.1
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->253 3b8bA PDBj 4e-22 31.0 %
:RPS:PDB   19->242 1awbA PDBj 7e-33 20.8 %
:RPS:SCOP  19->240 1awbA  e.7.1.1 * 2e-36 22.4 %
:HMM:SCOP  3->256 1jp4A_ e.7.1.1 * 7.9e-55 27.6 %
:RPS:PFM   32->238 PF00459 * Inositol_P 3e-18 27.0 %
:HMM:PFM   9->242 PF00459 * Inositol_P 2.4e-43 27.2 232/272  
:BLT:SWISS 36->250 CYSQ_ACTAC 7e-28 34.4 %
:PROS 85->98|PS00629|IMP_1
:PROS 212->226|PS00630|IMP_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21643.1 GT:GENE cysQ GT:PRODUCT cysQ protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(797070..797840) GB:FROM 797070 GB:TO 797840 GB:DIRECTION - GB:GENE cysQ GB:PRODUCT cysQ protein GB:PROTEIN_ID AAZ21643.1 GB:DB_XREF GI:71062640 GB:GENE:GENE cysQ LENGTH 256 SQ:AASEQ MNLEEKKKITLSLIETFNKASQVALDLRGAGLKKEIKSDNTPVSNGDIEVNKILTSKIQEITPNIPIVSEESTNHKMDNDLNTFWLIDPIDGTKDYINNRDEFTLNAALILDKKPAIGIITVPAKKRVFYSYGLSHSYELINNQEISLMNKEKNYVGHTAVSYSNDLKPEILEIHKKYKISSFQKMKSSLKFCVIAAGEFDMYVAEPRACEWDIAAGHAILEHSGGKVTDFNYNEILYGKTEFKNPSLILKSKNIL GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 36->250|CYSQ_ACTAC|7e-28|34.4|209/269| PROS 85->98|PS00629|IMP_1|PDOC00547| PROS 212->226|PS00630|IMP_2|PDOC00547| BL:PDB:NREP 1 BL:PDB:REP 38->253|3b8bA|4e-22|31.0|210/263| RP:PDB:NREP 1 RP:PDB:REP 19->242|1awbA|7e-33|20.8|221/272| RP:PFM:NREP 1 RP:PFM:REP 32->238|PF00459|3e-18|27.0|204/257|Inositol_P| HM:PFM:NREP 1 HM:PFM:REP 9->242|PF00459|2.4e-43|27.2|232/272|Inositol_P| GO:PFM:NREP 1 GO:PFM GO:0004437|"GO:inositol or phosphatidylinositol phosphatase activity"|PF00459|IPR000760| RP:SCP:NREP 1 RP:SCP:REP 19->240|1awbA|2e-36|22.4|219/272|e.7.1.1| HM:SCP:REP 3->256|1jp4A_|7.9e-55|27.6|246/304|e.7.1.1|1/1|Carbohydrate phosphatase| OP:NHOMO 758 OP:NHOMOORG 564 OP:PATTERN -------------------------11-2-2-----------------------------------11 --1--112----1-----------1------------1-1---1------------11-------------------------2-2-12222-2----------1121-1----------1111---21-21-1121111----2--1111111111--11111112112-31223221322211---11--1111111111-11111-111111111---1--11111-11--1111111111111--1111-------------11----------------------------------------------------------------------------------------------------------111--1-1111312422222222233333323332-1111212-14313221122222342222121321223231111111111111211------------1111111111111----111-11-----------1---------------1------1----------------1-2121-2222222121--1-1-1-1-1112--1--------1-------1111111111111-1-------1-111112223211232122222223222222332111-11211---11111111111111111111-11-1111111111111111212112111111111111111111211111111-11111111111111-222222----112131111211111112221111111---1111111111111111111111111111111131111111222111111111121112221222211-------------------------------------211111111-1- ---111--111---1-1--------------------------1------------------------1--1----1--1-11---------1---------111--1-2----1-----1-1-----------------1--1------1--1----1--1--11-3-36--2--11--1--1-2123-23------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 97.7 SQ:SECSTR ######HHHHHHHHHHHHHHHHHHHHTTcccccEEcccTTcEEcHHHHHHHHHHHHHHHHHcTTcEEEEHHHHHHTcccccccEEEEEEEEcHHHHHHTccccEEEEEEEETTEEEEEEEEETTTTEEEEEETTTEEEETETTEEccccccccGGGcEEEccccccccHHHHHHHHHHHHHHHTTTcHHHHHHHHHHTcccEEETEEcccHHHHHHHHHHHHHTTcEEEcTTcccccTTccEcccccEEEEcHHHH DISOP:02AL 143-153| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccEEEEEEcccccHHHHHccccEEEEEEEEEccEEEEEEEEEcccccEEEEEEccEEEEcccccEEEcccccccccEEEEEEEccccHHHHHHHHHcccccEEEEHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHcccEEEccccccccccccccccccEEEEccccc //