[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : dapB
DDBJ      :dapB         Dihydrodipicolinate reductase
Swiss-Prot:DAPB_PELUB   RecName: Full=Dihydrodipicolinate reductase;         Short=DHPR;         EC=1.3.1.26;

Homologs  Archaea  29/68 : Bacteria  780/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->255 3ijpB PDBj 6e-46 40.3 %
:RPS:PDB   1->166 1cqjA PDBj 4e-10 10.9 %
:RPS:SCOP  2->106 1cqiA1  c.2.1.8 * 6e-08 12.5 %
:RPS:SCOP  118->227 1arzA2  d.81.1.3 * 5e-24 36.2 %
:HMM:SCOP  3->260 1dihA1 c.2.1.3 * 9.1e-36 34.9 %
:RPS:PFM   4->115 PF01113 * DapB_N 2e-10 33.0 %
:RPS:PFM   119->255 PF05173 * DapB_C 3e-25 42.1 %
:HMM:PFM   119->255 PF05173 * DapB_C 1.9e-43 50.0 128/132  
:HMM:PFM   4->116 PF01113 * DapB_N 2.7e-30 33.6 113/124  
:BLT:SWISS 1->258 DAPB_PELUB e-146 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21188.1 GT:GENE dapB GT:PRODUCT Dihydrodipicolinate reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(356918..357694) GB:FROM 356918 GB:TO 357694 GB:DIRECTION - GB:GENE dapB GB:PRODUCT Dihydrodipicolinate reductase GB:PROTEIN_ID AAZ21188.1 GB:DB_XREF GI:71062185 GB:GENE:GENE dapB LENGTH 258 SQ:AASEQ MKKINLAISGCLGRMGQQLIKSSKNNKNFKLTALTENKAISKKIAGIKLDVNTEQTFKKTDVIIDFTVPNCTLDILKIASKLKKRVVIGTTGFNQKEEALIKKFSKTIPILKAGNMSLGVNLLMYLTEITSKSLNEEYLSKVFEVHHKHKKDYPSGTALMLGKGIADGKNKNLYNLMGKKFLNKKSFPYGKKINFNSIRKGEIIGEHEVTFSSGKEIIKLNHEAFDRALYSDGALTAAKWLINKKPGLYSMRDLLNFR GT:EXON 1|1-258:0| SW:ID DAPB_PELUB SW:DE RecName: Full=Dihydrodipicolinate reductase; Short=DHPR; EC=1.3.1.26; SW:GN Name=dapB; OrderedLocusNames=SAR11_0366; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Diaminopimelate biosynthesis; Lysine biosynthesis; NADP;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->258|DAPB_PELUB|e-146|100.0|258/258| GO:SWS:NREP 6 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0019877|"GO:diaminopimelate biosynthetic process"|Diaminopimelate biosynthesis| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| BL:PDB:NREP 1 BL:PDB:REP 4->255|3ijpB|6e-46|40.3|248/267| RP:PDB:NREP 1 RP:PDB:REP 1->166|1cqjA|4e-10|10.9|165/286| RP:PFM:NREP 2 RP:PFM:REP 4->115|PF01113|2e-10|33.0|112/123|DapB_N| RP:PFM:REP 119->255|PF05173|3e-25|42.1|133/136|DapB_C| HM:PFM:NREP 2 HM:PFM:REP 119->255|PF05173|1.9e-43|50.0|128/132|DapB_C| HM:PFM:REP 4->116|PF01113|2.7e-30|33.6|113/124|DapB_N| GO:PFM:NREP 6 GO:PFM GO:0008839|"GO:dihydrodipicolinate reductase activity"|PF01113|IPR000846| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01113|IPR000846| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01113|IPR000846| GO:PFM GO:0008839|"GO:dihydrodipicolinate reductase activity"|PF05173|IPR000846| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF05173|IPR000846| GO:PFM GO:0055114|"GO:oxidation reduction"|PF05173|IPR000846| RP:SCP:NREP 2 RP:SCP:REP 2->106|1cqiA1|6e-08|12.5|104/121|c.2.1.8| RP:SCP:REP 118->227|1arzA2|5e-24|36.2|105/110|d.81.1.3| HM:SCP:REP 3->260|1dihA1|9.1e-36|34.9|149/163|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 846 OP:NHOMOORG 816 OP:PATTERN -----------------------11--111111111111111112111111111-------------- 111--11111111111111-11--1111111111111111--11---1----1-1-----1-1111111-1-------1121111111111111111111111111111111111111111111111111111111-----111-1111111-1-11-111--111111111-11111-1111-----1111111111111111111111111111111111111111111111111111111111111111111--11-1-1-111111-11--1111-------11111111111111-------------111111111111112222222212122221111112--111111111111-111111--1-21111111111111111111111111111111111-1111111112111111221222111111111111111111111111111111-1111-11111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111---1111111111111111111211111111111111111111111111111111111112111111111111111111111111111--1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----1---1111111111111111111111-1111111111111111----------1-------------------------1111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------3--1--------------1------111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 257 STR:RPRED 99.6 SQ:SECSTR cTTcEEEEETTTcHHHHHHHHHHHHHTcEEEEEEcTTcTTTEEETTEEEEccHHHHHHHHcEEEEcccHHHHHHHHHHHHHHTccEEEccccccHHHHHHHHHHHHHTTcEEEcccccEEEETTTEEEEcccGGGccEEEEEEEEccHHHHHHHHHHHHHTcccEEHHTTcccHHHHEEccccccccccTTcEEEEEEEcTTccEEEEEEEEccccEEEEEEEEccTHHHHHHHHHHHHHTTTcccEEEcHcTTTTT# DISOP:02AL 184-186| PSIPRED cccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccccccccEEEccHHHHHHcccEEEEEccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHHcccccEEEHHHHcccc //