[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : dapF
DDBJ      :dapF         Diaminopimelate epimerase (DAP epimerase)
Swiss-Prot:DAPF_PELUB   RecName: Full=Diaminopimelate epimerase;         Short=DAP epimerase;         EC=5.1.1.7;

Homologs  Archaea  19/68 : Bacteria  672/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
d.21.1
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->210 1gqzA PDBj 4e-30 34.0 %
:RPS:PDB   3->264 1bwzA PDBj 3e-47 28.3 %
:RPS:SCOP  7->127 1bwzA1  d.21.1.1 * 4e-21 34.7 %
:RPS:SCOP  153->264 1bwzA2  d.21.1.1 * 6e-28 27.7 %
:HMM:SCOP  3->127 1bwzA1 d.21.1.1 * 5.9e-35 44.8 %
:HMM:SCOP  132->274 1bwzA2 d.21.1.1 * 1e-49 41.3 %
:RPS:PFM   5->116 PF01678 * DAP_epimerase 2e-16 39.3 %
:HMM:PFM   6->116 PF01678 * DAP_epimerase 1.3e-24 31.5 111/121  
:HMM:PFM   153->264 PF01678 * DAP_epimerase 1.6e-26 27.0 111/121  
:BLT:SWISS 1->274 DAPF_PELUB e-144 100.0 %
:PROS 63->77|PS01326|DAP_EPIMERASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21079.1 GT:GENE dapF GT:PRODUCT Diaminopimelate epimerase (DAP epimerase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 260349..261173 GB:FROM 260349 GB:TO 261173 GB:DIRECTION + GB:GENE dapF GB:PRODUCT Diaminopimelate epimerase (DAP epimerase) GB:PROTEIN_ID AAZ21079.1 GB:DB_XREF GI:71062076 GB:GENE:GENE dapF LENGTH 274 SQ:AASEQ MDIKAFKMDGLGNDFVIIDQRSQDFNLDKDQIIKICDRSFIGCDQLILIKKNKEIDANVEFFNSDGSISGACGNGTRCVADLLSKESGKKEITLLTTSGSLKSKILGNNLVETEIGIPKVNWQEIPLSKQLDTQDLKIEIIDRNNTKHIGGIAINVGNPHIIFFVDDIEAFDLKNIGPKIENHPLFPEKCNVTLAKVINRNLIKVKVWERGAGLTKACGTAACATAVAANINNLVEKTTDIEFVLGSLTISIDERNSIHMKGPVSDIKNINIKL GT:EXON 1|1-274:0| SW:ID DAPF_PELUB SW:DE RecName: Full=Diaminopimelate epimerase; Short=DAP epimerase; EC=5.1.1.7; SW:GN Name=dapF; OrderedLocusNames=SAR11_0257; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm; Isomerase;Lysine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|DAPF_PELUB|e-144|100.0|274/274| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| GO:SWS GO:0009085|"GO:lysine biosynthetic process"|Lysine biosynthesis| PROS 63->77|PS01326|DAP_EPIMERASE|PDOC01029| SEG 211->229|gagltkacgtaacatavaa| BL:PDB:NREP 1 BL:PDB:REP 7->210|1gqzA|4e-30|34.0|200/274| RP:PDB:NREP 1 RP:PDB:REP 3->264|1bwzA|3e-47|28.3|258/274| RP:PFM:NREP 1 RP:PFM:REP 5->116|PF01678|2e-16|39.3|112/120|DAP_epimerase| HM:PFM:NREP 2 HM:PFM:REP 6->116|PF01678|1.3e-24|31.5|111/121|DAP_epimerase| HM:PFM:REP 153->264|PF01678|1.6e-26|27.0|111/121|DAP_epimerase| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF01678|IPR001653| GO:PFM GO:0008837|"GO:diaminopimelate epimerase activity"|PF01678|IPR001653| GO:PFM GO:0009089|"GO:lysine biosynthetic process via diaminopimelate"|PF01678|IPR001653| RP:SCP:NREP 2 RP:SCP:REP 7->127|1bwzA1|4e-21|34.7|121/130|d.21.1.1| RP:SCP:REP 153->264|1bwzA2|6e-28|27.7|112/144|d.21.1.1| HM:SCP:REP 3->127|1bwzA1|5.9e-35|44.8|125/0|d.21.1.1|1/2|Diaminopimelate epimerase-like| HM:SCP:REP 132->274|1bwzA2|1e-49|41.3|143/0|d.21.1.1|1/1|Diaminopimelate epimerase-like| OP:NHOMO 747 OP:NHOMOORG 717 OP:PATTERN -----------------------1----1-1-111111111111-1111------------------- 11--111-111------------------------------1-1---------------------1-1-1--111--------11111111111---11111111111-1-1111111111111111111111111-----111--1111111111111111111112211111111111111-----111111111111111111111111111111111-1--11111121--------------------11-------1-11--11-11--------------------------------------------------111111111111111-11111112-1--1111111111-11111111--111-111111111111111111111111111111111-111111111111111112111111111111111111111111111111111111111-11111----11111111111111111111111111111222211111111111-1111211111111111-11111111111111111111111111111111111111111111111111111111111111211111-111111--11111111-111111111111111111111111111111111111-111111-111111111111111111111-1111111111111111111121111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111212121211111---------111111111111111111111111111111111111111------------------------------------1--11-----111 ----111--------------------------------------------1-------------------------------------------------------11-------------------------------------------------2----11---------21111811111---2-1211----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 267 STR:RPRED 97.4 SQ:SECSTR HHcEEEEEEETTEEEEEEETTcccccccHHHHHHHHcTTTccccEEEEEEccTTccEEEEEEETTccccccTTTTHHHHHHHHTTcccccEEEEEccccEEEEEEcTTccEEEEcccccccGGGTTcccccccccEEEEETTEEEEEEEEEEEEEcccEEEEEEcccTTTccHHHHHHHHHTcTTcTTccEEEEEEEEETTEEEEEEEETTTEEccccHHHHHHHHHHHHHTTcccccEEEEccccEEEEEcccTTccEEEEccEEE####### DISOP:02AL 274-275| PSIPRED ccEEEEEEccccccEEEEEcccccccccHHHHHHHHccccccccEEEEEEccccccEEEEEEEccccHHHccHHHHHHHHHHHHHcccccEEEEEEcccEEEEEEEcccEEEEEEEcccccHHHccccccccccEEEEEEEEccccEEEEEEEEcccccEEEEEEcccccccHHHHHHHHHccccccccEEEEEEEEccccEEEEEEEEccccccccccHHHHHHHHHHHHHccccccEEEEccccEEEEEEEcccEEEEEEcEEEEEEEEEEc //