[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : dctM
DDBJ      :dctM         TrapT family
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  305/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:443 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   19->434 PF06808 * DctM 2e-41 31.9 %
:HMM:PFM   16->434 PF06808 * DctM 7.2e-73 26.0 408/416  
:BLT:SWISS 10->440 SIAT_HAEI8 3e-27 23.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22095.1 GT:GENE dctM GT:PRODUCT TrapT family GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1226064..1227395) GB:FROM 1226064 GB:TO 1227395 GB:DIRECTION - GB:GENE dctM GB:PRODUCT TrapT family GB:NOTE TrapT family, dctM subunit GB:PROTEIN_ID AAZ22095.1 GB:DB_XREF GI:71063092 GB:GENE:GENE dctM LENGTH 443 SQ:AASEQ MLAQYLSYEFIALFMFITMLAMMFTGQRVFGAIGFVAVISALLVWGNGAIEMPYTATWKLFKWYPMLTLPLFIYMGFMISESGIASDLYKMFHVFFGGIKGGLAIGTMFMMVGISAMNGLSVAGMAIGATIALPEMLKRNYDKRMITGVVQAGSSLGILIPPSVVMVLYGMIARQPVSKLWLAGLLPGLLMATLFIIYIYVRCRLQPELGPVLSEKERNIPLKEKLKLLTAGIIPFVIFMSMTGLFLMGIASLVECSAVGALLATLASIYKKRFTRKVLDTTLRKTLGVSCMFMWIILAALCFGAVFDGLGAARAIETLFIERWHLTPWGVLIMMQLSYIFMGMFLDDTAMLVIVAPLYVPLIISLGFDPIWYGVLYTITCQIAYMTPPFGYNLFLMRAMAPKEITLSDIYKSITPFLLVMLLALILVMVFPQIATYLPNKYL GT:EXON 1|1-443:0| BL:SWS:NREP 1 BL:SWS:REP 10->440|SIAT_HAEI8|3e-27|23.1|416/616| TM:NTM 12 TM:REGION 4->26| TM:REGION 30->52| TM:REGION 60->82| TM:REGION 90->112| TM:REGION 116->137| TM:REGION 148->170| TM:REGION 180->202| TM:REGION 238->260| TM:REGION 293->315| TM:REGION 345->367| TM:REGION 375->397| TM:REGION 414->436| SEG 180->194|lwlagllpgllmatl| SEG 418->430|llvmllalilvmv| RP:PFM:NREP 1 RP:PFM:REP 19->434|PF06808|2e-41|31.9|407/412|DctM| HM:PFM:NREP 1 HM:PFM:REP 16->434|PF06808|7.2e-73|26.0|408/416|DctM| OP:NHOMO 876 OP:NHOMOORG 308 OP:PATTERN ----------------------------1-------------------------------1------- --------1121-------------2--------------------1-------1-----------1---1-------------------------------------1-------------------------1111111-----111-11--------1-1-1--11-1-1-----1-------3311-------------------5211---------4-----------------------------------------------------------------------------------------------------71-----------------------1--11--23-2-1--21-----2---------------B881136345411111111113-22322422A12-24422274338864111FFA88BCFAK--------1----421-----------------------------3-----2LH8G2111111----223------1112325312---7334433F6953231----2--------1-464-2E37464--5222-1211-111-1111---1-22-1-------1-------12311------334-1-A21111-1-111111--114---1212------21---1----1-11111--1-1111-2---------3---111------------------2---------111111111111---1----------17EN---312-1111-225-------11-112222-112511124121---------2--143333333446----------------2-11---------------------------------------------11121--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 215-217| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //