[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ddlB
DDBJ      :ddlB         D-alanine--D-alanine ligase B
Swiss-Prot:DDL_PELUB    RecName: Full=D-alanine--D-alanine ligase;         EC=6.3.2.4;AltName: Full=D-alanylalanine synthetase;AltName: Full=D-Ala-D-Ala ligase;

Homologs  Archaea  3/68 : Bacteria  842/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
c.30.1d.142.1
:304 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->298 1iovA PDBj 9e-43 37.4 %
:RPS:PDB   3->297 3e5nA PDBj 1e-37 26.3 %
:RPS:SCOP  1->96 1iovA1  c.30.1.2 * 2e-20 41.7 %
:RPS:SCOP  96->300 1e4eA2  d.142.1.1 * 1e-35 27.3 %
:HMM:SCOP  1->96 1iowA1 c.30.1.2 * 2.1e-27 48.4 %
:HMM:SCOP  96->303 1ehiA2 d.142.1.1 * 4.7e-43 33.7 %
:RPS:PFM   4->86 PF01820 * Dala_Dala_lig_N 5e-10 45.8 %
:RPS:PFM   136->298 PF07478 * Dala_Dala_lig_C 1e-28 44.4 %
:HMM:PFM   107->297 PF07478 * Dala_Dala_lig_C 2e-49 31.9 191/203  
:HMM:PFM   3->45 PF01820 * Dala_Dala_lig_N 2.5e-09 37.2 43/117  
:HMM:PFM   50->86 PF01820 * Dala_Dala_lig_N 8.9e-14 51.4 37/117  
:BLT:SWISS 1->304 DDL_PELUB e-158 100.0 %
:PROS 63->74|PS00843|DALA_DALA_LIGASE_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20846.1 GT:GENE ddlB GT:PRODUCT D-alanine--D-alanine ligase B GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(23211..24125) GB:FROM 23211 GB:TO 24125 GB:DIRECTION - GB:GENE ddlB GB:PRODUCT D-alanine--D-alanine ligase B GB:PROTEIN_ID AAZ20846.1 GB:DB_XREF GI:71061843 GB:GENE:GENE ddlB LENGTH 304 SQ:AASEQ MTKKILILSGGISKERLISLDTGKQVAKELIKNGYKVLISEPDKNLSKNITSFKPDVIFNALHGQFGEDGYIQAILETKKIPYTHSGVIASSIAMDKEISKKIFIKNKILTPKYIKFNHKKNKLNIIKLIEKNLKFPVVVKPINEGSSVHVYICDKTNILKNLKVLKSYNEILIEEFIPGREIQVAIMNNKSLGAIELEPRRKFYDYEAKYNSSAKTKHLIPVDLSKNNLAKITGIARAAHKIIGCKGVTRSDFKFFNGKFYLLEINTQPGMTKLSLVPEIAKHKGISFIKLIEWILKDASINR GT:EXON 1|1-304:0| SW:ID DDL_PELUB SW:DE RecName: Full=D-alanine--D-alanine ligase; EC=6.3.2.4;AltName: Full=D-alanylalanine synthetase;AltName: Full=D-Ala-D-Ala ligase; SW:GN Name=ddl; OrderedLocusNames=SAR11_0021; SW:KW ATP-binding; Cell shape; Cell wall biogenesis/degradation;Complete proteome; Cytoplasm; Ligase; Magnesium; Manganese;Metal-binding; Nucleotide-binding; Peptidoglycan synthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->304|DDL_PELUB|e-158|100.0|304/304| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0008360|"GO:regulation of cell shape"|Cell shape| GO:SWS GO:0007047|"GO:cellular cell wall organization"|Cell wall biogenesis/degradation| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009252|"GO:peptidoglycan biosynthetic process"|Peptidoglycan synthesis| PROS 63->74|PS00843|DALA_DALA_LIGASE_1|PDOC00659| SEG 115->135|ikfnhkknklniiklieknlk| BL:PDB:NREP 1 BL:PDB:REP 1->298|1iovA|9e-43|37.4|297/306| RP:PDB:NREP 1 RP:PDB:REP 3->297|3e5nA|1e-37|26.3|281/340| RP:PFM:NREP 2 RP:PFM:REP 4->86|PF01820|5e-10|45.8|83/108|Dala_Dala_lig_N| RP:PFM:REP 136->298|PF07478|1e-28|44.4|162/199|Dala_Dala_lig_C| HM:PFM:NREP 3 HM:PFM:REP 107->297|PF07478|2e-49|31.9|191/203|Dala_Dala_lig_C| HM:PFM:REP 3->45|PF01820|2.5e-09|37.2|43/117|Dala_Dala_lig_N| HM:PFM:REP 50->86|PF01820|8.9e-14|51.4|37/117|Dala_Dala_lig_N| GO:PFM:NREP 5 GO:PFM GO:0005618|"GO:cell wall"|PF01820|IPR011127| GO:PFM GO:0008716|"GO:D-alanine-D-alanine ligase activity"|PF01820|IPR011127| GO:PFM GO:0009252|"GO:peptidoglycan biosynthetic process"|PF01820|IPR011127| GO:PFM GO:0008716|"GO:D-alanine-D-alanine ligase activity"|PF07478|IPR011095| GO:PFM GO:0009252|"GO:peptidoglycan biosynthetic process"|PF07478|IPR011095| RP:SCP:NREP 2 RP:SCP:REP 1->96|1iovA1|2e-20|41.7|96/96|c.30.1.2| RP:SCP:REP 96->300|1e4eA2|1e-35|27.3|198/211|d.142.1.1| HM:SCP:REP 1->96|1iowA1|2.1e-27|48.4|93/0|c.30.1.2|1/1|PreATP-grasp domain| HM:SCP:REP 96->303|1ehiA2|4.7e-43|33.7|208/228|d.142.1.1|1/1|Glutathione synthetase ATP-binding domain-like| OP:NHOMO 1053 OP:NHOMOORG 856 OP:PATTERN ----------------------------------------------1-----1--------------1 121-3111---21111111-111111111111-111111121131211233111111111223222212121111111221121121111111111---11111111--111111111-1-----111111111211111111111-1111111111111111111111-1111111111111111111111111121222212222221111112221112111111111331111111111111111111121111111-1-111111111111111111111111111111121111111111111111111111111111421111111111111211122132111112112211111111111111111-211111111115221111111122222222221-11-111111211211122222211111111131111111111111111111111111--------1111111111111111111111111111111111111111111111111112111111111111111111111111111112111111111111111121111111111-111111111122223222111-111111-11--1--11-1111111111111111212111111111111111111-1111111----22112212222222222-2222222222222122222222111112221222222222212222222221121111111111111111111111111121111111111111111111111111111122221212121331222111-111111111211111111112212222222111111112211111111111111--------------------------1212213112121 -----------------------1-1---------------------------------111-----------------------------------------------------------------------------------------------------1---------1-----------2--1--1------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 304 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEcccTTHHHHHHHHHHHHHHccTTTEEEEEEEEcTTccEEEEcGGGcEEEEEEccHHHHccHHHHHHHHTTcccccccHHHHHHHHcHHHHHHHHHHTTcccccEEEEEHHHHTTccHHHHHHHHcccEEEEEccccccTTcEEEccGGGHHHHHHTTTccEEEEEEccccEEEEEEEEcccccEEEEEEEEEccccHHHHTTccTcccEEccccccHHHHHHHHHHHHHHHHHHTcccEEEEEEEEcTccEEEEEEEccccccTTcHHHHHHHTTTccHHHHHHHHHHHHcHTc PSIPRED cccEEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHccccEEcccHHHHHHHccHHHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHccccEEEEEccccccEEEEEEccHHHHHHHHHHcccccEEEEEccccEEEEEEEEccccccEEEEEccccEEcccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEEccccccccccHHHHHHHHHcccHHHHHHHHHHHHcccc //