[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : def
DDBJ      :def          peptide deformylase
Swiss-Prot:DEF_PELUB    RecName: Full=Peptide deformylase;         Short=PDF;         EC=3.5.1.88;AltName: Full=Polypeptide deformylase;

Homologs  Archaea  1/68 : Bacteria  888/915 : Eukaryota  63/199 : Viruses  0/175   --->[See Alignment]
d.167.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->149 1n5nA PDBj 1e-40 53.1 %
:RPS:PDB   1->149 3cpmA PDBj 3e-56 34.2 %
:RPS:SCOP  2->149 1bs4A  d.167.1.1 * 4e-50 51.0 %
:HMM:SCOP  2->170 1y6hA_ d.167.1.1 * 3e-64 46.2 %
:RPS:PFM   13->148 PF01327 * Pep_deformylase 7e-35 55.9 %
:HMM:PFM   4->155 PF01327 * Pep_deformylase 3e-59 50.0 152/157  
:BLT:SWISS 1->172 DEF_PELUB 6e-85 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21278.1 GT:GENE def GT:PRODUCT peptide deformylase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 451748..452266 GB:FROM 451748 GB:TO 452266 GB:DIRECTION + GB:GENE def GB:PRODUCT peptide deformylase GB:PROTEIN_ID AAZ21278.1 GB:DB_XREF GI:71062275 GB:GENE:GENE def LENGTH 172 SQ:AASEQ MSVKSILTEPNKLLRQISKPVENVGDEERRLMDDMLDTMYAAPGIGLAAIQIGVPKRIIVMDISRDEDKKEPRYFVNPVIKNKNDITSKYEEGCLSVPDQFAEIERPNECEVEYLDYNGKKQLLKADGLLATCIQHEMDHLEGVLFIDYLSKLKKSMIIKKLSKIKSNRIIV GT:EXON 1|1-172:0| SW:ID DEF_PELUB SW:DE RecName: Full=Peptide deformylase; Short=PDF; EC=3.5.1.88;AltName: Full=Polypeptide deformylase; SW:GN Name=def; OrderedLocusNames=SAR11_0456; SW:KW Complete proteome; Hydrolase; Iron; Metal-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->172|DEF_PELUB|6e-85|100.0|172/172| GO:SWS:NREP 3 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| SEG 150->167|lsklkksmiikklskiks| BL:PDB:NREP 1 BL:PDB:REP 1->149|1n5nA|1e-40|53.1|147/167| RP:PDB:NREP 1 RP:PDB:REP 1->149|3cpmA|3e-56|34.2|149/184| RP:PFM:NREP 1 RP:PFM:REP 13->148|PF01327|7e-35|55.9|136/155|Pep_deformylase| HM:PFM:NREP 1 HM:PFM:REP 4->155|PF01327|3e-59|50.0|152/157|Pep_deformylase| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF01327|IPR000181| GO:PFM GO:0006412|"GO:translation"|PF01327|IPR000181| GO:PFM GO:0042586|"GO:peptide deformylase activity"|PF01327|IPR000181| RP:SCP:NREP 1 RP:SCP:REP 2->149|1bs4A|4e-50|51.0|145/168|d.167.1.1| HM:SCP:REP 2->170|1y6hA_|3e-64|46.2|169/0|d.167.1.1|1/1|Peptide deformylase| OP:NHOMO 1468 OP:NHOMOORG 952 OP:PATTERN ---------------------------------------------2---------------------- 1211322222222211111-111111111111111132211221221132223332231144212233422122222211121122221111-11111111111121111111111111111112111111111111111111121222222222111111211112222212111112111111111111122222222222222222111122222222312111111131222222222222222122121111111111111111121111-1111222222211111111111112222222222222211222222211323444443334222442332111111241111121111111111111-11111111111212111111111122222221222-22222122112122222222222222111233333323322222222222221222232222211113233133331221111111111122222111111222221122222222212222212222222222222223322222121111111222222111111111111111222222222111133111111111111111111111111111222111112121223333322333323223221-1112111111111111111111111121-1111111111111111111112112121111111111111111111111111111111111111111111111-2333211111111111111111112222212111112222222212222122222212222211112222221212211222222221111112111111111-1111111-------1---111---1-1-11---1111111111112 11--11--1---111--------------------------------------------------------------------------------------------121211111-----11111-1-131--11------121-------11---12------2-2-18--2213229222114313-32-221113 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 86.6 SQ:SECSTR ccccccccTTcGGGTccccccccccHHHHHHHHHHHHHHHHTTccEEEGGGGTccccEEEEcccccTTccccEEEEEEEEEEEcccEEEEEEccTTcTTccEEEEEEccEEEEEEcTTccEEEEEEcHHHHHHHHHHHHHHTTccGGGG####################### DISOP:02AL 172-173| PSIPRED cccHHHHHcccHHHcccccccccccHHHHHHHHHHHHHHHHccccEEEcccccccEEEEEEEccccccccccEEEEEEEEEEEcccEEEEcccccccccEEEEEEcccEEEEEEEcccccEEEEEEEccEEEEEEHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHccccc //