[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : dhlB
DDBJ      :dhlB         (S)-2-haloacid dehalogenase
Swiss-Prot:             

Homologs  Archaea  23/68 : Bacteria  214/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:220 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->219 1judA PDBj 3e-48 39.4 %
:RPS:PDB   1->220 3ddhA PDBj 9e-27 22.1 %
:RPS:SCOP  4->194 1aq6A  c.108.1.1 * 3e-52 37.0 %
:HMM:SCOP  1->217 1zs9A1 c.108.1.22 * 9.8e-47 29.6 %
:RPS:PFM   65->172 PF00702 * Hydrolase 1e-06 27.9 %
:HMM:PFM   4->171 PF00702 * Hydrolase 4.8e-22 23.5 162/192  
:BLT:SWISS 1->219 HAD_PSEUY 5e-48 39.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20961.1 GT:GENE dhlB GT:PRODUCT (S)-2-haloacid dehalogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 144244..144906 GB:FROM 144244 GB:TO 144906 GB:DIRECTION + GB:GENE dhlB GB:PRODUCT (S)-2-haloacid dehalogenase GB:PROTEIN_ID AAZ20961.1 GB:DB_XREF GI:71061958 GB:GENE:GENE dhlB LENGTH 220 SQ:AASEQ MKNIKAIIFDAYGTLFDVNSAAEKCKDKIGDKWEGFANYWRTTQLEYTWLRSLMNRHKDFWQVTEDSLDKSMKAYEIDLSMKNELLNLYKVLSPFPEVPEILKRLKEKNYKLGILSNGTPSLLDELVKSNNLDNIFDDIFSIEEVGIYKPDSKVYDMPIKKYKIQKEEVAFLSANTWDVSGGGNYGYNSIWVNRNNNIFDNLDYKPEDEVKNLKQLLDII GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 1->219|HAD_PSEUY|5e-48|39.3|219/232| BL:PDB:NREP 1 BL:PDB:REP 4->219|1judA|3e-48|39.4|216/220| RP:PDB:NREP 1 RP:PDB:REP 1->220|3ddhA|9e-27|22.1|213/222| RP:PFM:NREP 1 RP:PFM:REP 65->172|PF00702|1e-06|27.9|104/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 4->171|PF00702|4.8e-22|23.5|162/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 4->194|1aq6A|3e-52|37.0|189/245|c.108.1.1| HM:SCP:REP 1->217|1zs9A1|9.8e-47|29.6|216/0|c.108.1.22|1/1|HAD-like| OP:NHOMO 352 OP:NHOMOORG 267 OP:PATTERN ------1111111211--------1---1-1-111-------------------2332211------- --2------------11--------2-----------1----------------------------1-1-------------1-----11----11---1---1---1-----------------1----1---11-11------1----11---------------1111--------------------1--22222332-43232411--1-3331---211------12-1111111111111121134----------1------111----11--------------------------------------11------112---111--1--2---111---1-----1----------------1--1---------1-111--11-1--11111-11111-1111111211--------1--112-11--11-----111--------1----1-------------------------------1------11-131111321111112211111121211111111111----1311-111----------------1----1-------------1-1---1-11-1-1--------------------------------2--111111-----2-----------------1---------------------------------------------1----------------------------------------------------------1-1-111--------1----------11---------1---------------------------------------------------------------------------------------------------1-1-1--- ---------------1---21-22122111111-------------122333331-3-1------------------------------12---2---------1---2------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 100.0 SQ:SECSTR TTTccEEEEcccTTTcccHHHHHHHHHHTGGGccHHHHHHHHHHHHHTHHHHHcccHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHTTcccccTTHHHHHHHHHHHccEEEEEEEccHHHHHHHHHHHTcGGGccEEEEGGGcccccccHHHHHHHHHHHTccGGGEEEEcccccccHHHHHHTcEEEEccccTccccccccTTEEEcccGGGHHHHc PSIPRED cccccEEEEEccccEEccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHcccHHHccEEEEHHHcccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEcccccccccccccccEEEccHHHHHHcc //