[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : dhs
DDBJ      :dhs          2-dehydro-3-deoxy-phosphoheptonate aldolase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  233/915 : Eukaryota  95/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:459 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->445 2w1aA PDBj e-113 46.5 %
:RPS:PDB   13->442 2b7oB PDBj 1e-60 38.5 %
:RPS:SCOP  13->445 2b7oA1  c.1.10.8 * 0.0 44.6 %
:HMM:SCOP  1->446 2b7oA1 c.1.10.8 * 5.5e-193 57.6 %
:RPS:PFM   4->441 PF01474 * DAHP_synth_2 e-173 61.1 %
:HMM:PFM   3->440 PF01474 * DAHP_synth_2 1.8e-208 58.4 438/439  
:BLT:SWISS 4->453 AROF_ARATH e-157 56.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21953.1 GT:GENE dhs GT:PRODUCT 2-dehydro-3-deoxy-phosphoheptonate aldolase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(1103786..1105165) GB:FROM 1103786 GB:TO 1105165 GB:DIRECTION - GB:GENE dhs GB:PRODUCT 2-dehydro-3-deoxy-phosphoheptonate aldolase GB:PROTEIN_ID AAZ21953.1 GB:DB_XREF GI:71062950 GB:GENE:GENE dhs LENGTH 459 SQ:AASEQ MKNWKINSWRNYPVKHIPEYPDQKELDGVLSKIKDFPPLVFAGETRHLKEQLADVVDGKAFLLQGGDCAESFAEFHPDNIRDTFKLILQMSLVLTYSASLPVIKLGRIAGQFSKPRSSPVENIDGVELPSYLGDNINGMEFNEKSRVPDPKRLFKAYSQSASTLNLIRAFSHGGFADLKKVHTWNLGFIKNSPAAKKFKDLEDRIADALAFMDACGINSDFNRRLKTVNFWTSHEALLLPFEQAMTRVDSTTGEYHDTSAHFVWIGDRTRQLDGGHVEFCRGIENPIGIKCGPTLKAEDLINLCNKINPNNEKGKITLISRFGHENVSKFLPKLIRAIKKEGLNVIWSCDPCHGNTIKATTGFKTRPFNSVVKEVKNVFECHQSEGSYAGGLHIEMTGQNVTECTGGAQKISDQDLSSRYHTHCDPRLNANQALELAFLISDEIKKNAAYSKKNIKAAS GT:EXON 1|1-459:0| BL:SWS:NREP 1 BL:SWS:REP 4->453|AROF_ARATH|e-157|56.6|449/525| BL:PDB:NREP 1 BL:PDB:REP 13->445|2w1aA|e-113|46.5|419/451| RP:PDB:NREP 1 RP:PDB:REP 13->442|2b7oB|1e-60|38.5|400/438| RP:PFM:NREP 1 RP:PFM:REP 4->441|PF01474|e-173|61.1|435/436|DAHP_synth_2| HM:PFM:NREP 1 HM:PFM:REP 3->440|PF01474|1.8e-208|58.4|438/439|DAHP_synth_2| GO:PFM:NREP 2 GO:PFM GO:0003849|"GO:3-deoxy-7-phosphoheptulonate synthase activity"|PF01474|IPR002480| GO:PFM GO:0009073|"GO:aromatic amino acid family biosynthetic process"|PF01474|IPR002480| RP:SCP:NREP 1 RP:SCP:REP 13->445|2b7oA1|0.0|44.6|413/449|c.1.10.8| HM:SCP:REP 1->446|2b7oA1|5.5e-193|57.6|439/0|c.1.10.8|1/1|Aldolase| OP:NHOMO 404 OP:NHOMOORG 328 OP:PATTERN -------------------------------------------------------------------- --11111111111121111-11112111111111111111111111111111111111112211114121--------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111-11111111111-1111112111111111111111111111111111111111111-----------------------------111111-----------2--------------1----------------------------------------------1-1----------1-1----------11--11-1111111111111111111111-----1---1111----------------------------------------------------------------------------1-----------------------------------------1-----1122----1---------------------------33331111111111111------------------------1111111111------1-------------------------------------------------------- ------1-----1111111122221211111112221111111111112112122111-1111--------------------------12111111111111111-12------------------------------------------------------1-----------2111I1111274851311211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 433 STR:RPRED 94.3 SQ:SECSTR ############cccccccccHHHHHHHHHHTHTTccccccHHHHHHHHHHHHHHHTTccEEEEEEccccccTccHHHHHHHHHHHHHHHHHHHHHHTcEEEEEEccccccccccccccTTcccccccTTccccccHHHHcccTTHHHHHHHHHTccccHHHHHHHHHHHHTcGGGcHHHHHHHHHHHHHccTTHHHHHHHHHHHHHHHHHHHTTcTEEccGGGcccccEEEEEEcccHHHHHHEEEccTTcccEEETTccEEEEcTTcccTTcHHHHHHHHccccEEEEEcTTcHEHHHHHHHHHHcTTccTTcEEEEEcccTTTHHHHHHHHHHHHHHTTcccEEEEcccTTccccHTTccccccHHHHHHHHHHHHHHHHHHTccccEEEEEcccccccccccTTTTccTTGccccccccccccccHHHHHHHHHHHHHHHc############## DISOP:02AL 1-2, 443-459| PSIPRED ccccccHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEcccHHccHHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHcccccccccccEEEccEEccEEEccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccEEcHHHHHHHHcccccccccccccccEEEccccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHcHHHHHHHHHcccEEEEEEcccccccEEcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHccccHHHccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccc //