[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : dsbA
DDBJ      :dsbA         2-hydroxychromene-2-carboxylate isomerase family protein (HCCA Isomerase)
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  92/915 : Eukaryota  26/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->182 3fz5C PDBj 1e-13 27.5 %
:RPS:PDB   103->181 1bedA PDBj 8e-07 12.7 %
:RPS:SCOP  1->188 1r4wA  c.47.1.13 * 1e-34 19.1 %
:HMM:SCOP  1->193 1r4wA_ c.47.1.13 * 1.8e-35 29.5 %
:RPS:PFM   4->184 PF01323 * DSBA 1e-12 28.1 %
:HMM:PFM   4->190 PF01323 * DSBA 2.1e-35 23.1 186/193  
:BLT:SWISS 5->183 NAHD_PSEU8 2e-12 27.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21639.1 GT:GENE dsbA GT:PRODUCT 2-hydroxychromene-2-carboxylate isomerase family protein (HCCA Isomerase) GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(795290..795874) GB:FROM 795290 GB:TO 795874 GB:DIRECTION - GB:GENE dsbA GB:PRODUCT 2-hydroxychromene-2-carboxylate isomerase family protein (HCCA Isomerase) GB:PROTEIN_ID AAZ21639.1 GB:DB_XREF GI:71062636 GB:GENE:GENE dsbA LENGTH 194 SQ:AASEQ MIKEIDFYFDFISPYAYLAYQKIQTLPKDIRINYKPILLGGLHNLEGITAPAFIKPKLKHMINDCLLIAKKNNFDFKWNSKFPLNSLIIMRGYLDISSSNQAQYIKTMFDAYWKDDLDISKEEILIPLLEQCKIDKDIFFKTIKDPVIKEKLKNATKNAHEKEVFGAPTFIVNNKIFWGQDRLEFALDEYNKVD GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 5->183|NAHD_PSEU8|2e-12|27.1|177/212| SEG 133->145|kidkdiffktikd| BL:PDB:NREP 1 BL:PDB:REP 5->182|3fz5C|1e-13|27.5|167/187| RP:PDB:NREP 1 RP:PDB:REP 103->181|1bedA|8e-07|12.7|79/181| RP:PFM:NREP 1 RP:PFM:REP 4->184|PF01323|1e-12|28.1|167/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 4->190|PF01323|2.1e-35|23.1|186/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 1->188|1r4wA|1e-34|19.1|188/221|c.47.1.13| HM:SCP:REP 1->193|1r4wA_|1.8e-35|29.5|193/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 159 OP:NHOMOORG 118 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2111-------23411-32333----------1-----1--11-4-------------11121--11-11--1-------------111-----------------------------111-1-111-1111111-----112-------1121422-133122-1111122-1-1----------------111------------------1---------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1-----1111111-11111----------------------------11----------------------------------------------------------------------- ------1-------1-21211112---11-1-1---------------------------1-------------------------------2--------------1---1---1---------------------------------------111---------------12--------------2----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 97.9 SQ:SECSTR ##EEEEEEEcTTcHHHHHHHHHHHHHHHHHcEEEEEccccHHHHHTccccHHHHHHHHHHHTTTTTTccEEEEEEcccccTTHHHHHHHHHHHHHHcGGGHHHHHHHHHHHHTTcccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHTcccccEEEETTTEEEcGGcHHHHHHHHHH## DISOP:02AL 50-51| PSIPRED cccEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEEEEccccHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEEccEEccccccHHHHHHHHHccc //