[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ecpD
DDBJ      :ecpD         Fimbrial protein pilin precursor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.24.1
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->27 1ay2A  d.24.1.1 * 1e-04 51.9 %
:HMM:SCOP  1->145 1oqwA_ d.24.1.1 * 7.7e-11 16.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ22022.1 GT:GENE ecpD GT:PRODUCT Fimbrial protein pilin precursor GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 1163669..1164238 GB:FROM 1163669 GB:TO 1164238 GB:DIRECTION + GB:GENE ecpD GB:PRODUCT Fimbrial protein pilin precursor GB:PROTEIN_ID AAZ22022.1 GB:DB_XREF GI:71063019 GB:GENE:GENE ecpD LENGTH 189 SQ:AASEQ MVVAIIGILSSVGVVAYNGYTAGAKESACKGNFRTLVKSVYENIMWCELNPTINFIGGNDKQVWEYDCNTMFVGGMSVSSQLGYTTNEKIAHLTITEISNRDRHREPDSTIGSRTTLNTISNPYTGRYVYDDTPSEYYYGDKYDMRGKLSLRKRDSSGNELSNNWQSEGQLYLITRCGDKVIEHEFDIY GT:EXON 1|1-189:0| RP:SCP:NREP 1 RP:SCP:REP 1->27|1ay2A|1e-04|51.9|27/158|d.24.1.1| HM:SCP:REP 1->145|1oqwA_|7.7e-11|16.1|118/144|d.24.1.1|1/1|Pili subunits| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 101-109, 149-165| PSIPRED cEEEEEEHHHcccEEEEccccccccccccccHHHHHHHHHHHcEEEEEEccEEEEEcccccEEEEEcccEEEEEccccccccccccccEEEEEEEEEcccccccccccccccccEEEccccccccccEEEccccccEEEccccccccEEEEEEccccccccccccccccEEEEEEEcccHHHHHccccc //