[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : fbcH
DDBJ      :fbcH         ubiquinol-cytochrome-c reductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  147/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
a.3.1f.23.11
:259 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   34->257 1l0nD PDBj 1e-60 52.9 %
:RPS:PDB   33->257 3cwbD PDBj 6e-84 48.2 %
:RPS:SCOP  33->220 1bccD2  a.3.1.3 * 8e-83 54.1 %
:HMM:SCOP  23->220 1bccD2 a.3.1.3 * 7.8e-65 48.2 %
:HMM:SCOP  221->258 1bccD3 f.23.11.1 * 0.00023 34.2 %
:RPS:PFM   35->252 PF02167 * Cytochrom_C1 3e-55 52.6 %
:HMM:PFM   34->254 PF02167 * Cytochrom_C1 1.4e-92 59.2 218/219  
:BLT:SWISS 15->232 CY12_SOLTU 5e-64 52.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ20922.1 GT:GENE fbcH GT:PRODUCT ubiquinol-cytochrome-c reductase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(110461..111240) GB:FROM 110461 GB:TO 111240 GB:DIRECTION - GB:GENE fbcH GB:PRODUCT ubiquinol-cytochrome-c reductase GB:PROTEIN_ID AAZ20922.1 GB:DB_XREF GI:71061919 GB:GENE:GENE fbcH LENGTH 259 SQ:AASEQ MKNILKISYSIIFLLVGTLTVNAAEKVDLLKTDWSFKGLFGKFDRGSLQRGYQVYTEVCASCHSMKYVSYRNLFEPGGPEFTEEQAKAIAASFEVTDGPNNDGEMFVRPAKLSDKFVMPYENVKAAQAANGGAYPPDMSVLAKARTGGVDYIYSLLLGYEDPPSGVTLDDGVYYNKFMYGNNIKMAEPLSDGLVEYSDGTTASKEQMAKDVTTFLMWAAEPHLESRHKMGFKAILYLIILTILVYFSMKKIWSRIESEV GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 15->232|CY12_SOLTU|5e-64|52.6|215/260| TM:NTM 2 TM:REGION 3->25| TM:REGION 228->248| SEG 234->243|ilyliiltil| BL:PDB:NREP 1 BL:PDB:REP 34->257|1l0nD|1e-60|52.9|221/241| RP:PDB:NREP 1 RP:PDB:REP 33->257|3cwbD|6e-84|48.2|222/241| RP:PFM:NREP 1 RP:PFM:REP 35->252|PF02167|3e-55|52.6|209/213|Cytochrom_C1| HM:PFM:NREP 1 HM:PFM:REP 34->254|PF02167|1.4e-92|59.2|218/219|Cytochrom_C1| GO:PFM:NREP 3 GO:PFM GO:0005506|"GO:iron ion binding"|PF02167|IPR002326| GO:PFM GO:0009055|"GO:electron carrier activity"|PF02167|IPR002326| GO:PFM GO:0020037|"GO:heme binding"|PF02167|IPR002326| RP:SCP:NREP 1 RP:SCP:REP 33->220|1bccD2|8e-83|54.1|185/195|a.3.1.3| HM:SCP:REP 23->220|1bccD2|7.8e-65|48.2|195/195|a.3.1.3|1/1|Cytochrome c| HM:SCP:REP 221->258|1bccD3|0.00023|34.2|38/46|f.23.11.1|1/1|Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor| OP:NHOMO 379 OP:NHOMOORG 325 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--1111111111111111111111111111111111111-1111111111111-1111111111111222222221111-11111111121111111111111111111111111111--------------------------------------------------------1------------------------------------------------------------------------------------111111-111111111-1-------1------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1-----1111--1-------------------------------------------------------- 11--111-311-11111111111111111111111111111111111111111111111111111111111111111-1111111111-12111111111111212-121212111---11-1111111171-111-1-1111211121-11-1---11--111111221211111111I1111142321211111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 235 STR:RPRED 90.7 SQ:SECSTR ######################ccccccccccccTTccTTccccHHHHHHHHHHHHHTGGGTcccTTccHHHHccccTTTccHHHHHHHHHTcEEEEccccccccEEEEccTTcccccccccHHHHHHTTTTccccccccHHHHcTTTHHHHHHHHHHcccccTTccccTTcEEccccTTcEEcccccccTTccccTTcccccHHHHHHHHHHHHHHHHcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH## PSIPRED cHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccHHHcccccccHHHHHHHHccccccccccEEEEEccccHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //