[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : fbp
DDBJ      :fbp          peptidylprolyl isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  219/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
c.46.1d.26.1
:248 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->127 1c9hA PDBj 6e-13 34.6 %
:RPS:PDB   22->126 3chxA PDBj 1e-16 14.6 %
:RPS:PDB   122->244 2a2kA PDBj 8e-15 15.7 %
:RPS:SCOP  22->127 1u79A  d.26.1.1 * 2e-16 32.7 %
:RPS:SCOP  130->241 1tq1A  c.46.1.3 * 2e-16 21.8 %
:HMM:SCOP  7->130 1fd9A_ d.26.1.1 * 7.9e-31 36.9 %
:HMM:SCOP  126->246 1tq1A_ c.46.1.3 * 1.2e-15 26.9 %
:RPS:PFM   43->125 PF00254 * FKBP_C 1e-13 38.6 %
:RPS:PFM   134->237 PF00581 * Rhodanese 8e-06 34.3 %
:HMM:PFM   32->125 PF00254 * FKBP_C 1.2e-25 41.5 94/96  
:HMM:PFM   137->240 PF00581 * Rhodanese 1.1e-14 27.7 101/113  
:BLT:SWISS 26->129 FKBP_NEIMA 2e-15 33.7 %
:BLT:SWISS 132->244 Y744_HAEIN 1e-04 32.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21675.1 GT:GENE fbp GT:PRODUCT peptidylprolyl isomerase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION 828655..829401 GB:FROM 828655 GB:TO 829401 GB:DIRECTION + GB:GENE fbp GB:PRODUCT peptidylprolyl isomerase GB:NOTE contains rhodanese domain GB:PROTEIN_ID AAZ21675.1 GB:DB_XREF GI:71062672 GB:GENE:GENE fbp LENGTH 248 SQ:AASEQ MKKILIFICTIFLSLSFHVQSVEIEIINDKPGTGKKIIKHSWVQLEYTGSFENGKVFDTNIGKDRPLVVQMSMKEVIPGFEQGIMGTTKGTKRKIKIPAELAYGKKGGGDIIPPNTDLIFEFEVIDVLDPSYKSVSSDELIEMIENNAVALDIRTEEEWDKTGVIKGSFPETAFDKNGKFQVYVMDKIRALAASQSQDVNLIFISHDGETASMLANSFSEDLGFTNVSVLKGGIKAWQSENKKLGPHK GT:EXON 1|1-248:0| BL:SWS:NREP 2 BL:SWS:REP 26->129|FKBP_NEIMA|2e-15|33.7|104/109| BL:SWS:REP 132->244|Y744_HAEIN|1e-04|32.3|99/148| SEG 83->97|gimgttkgtkrkiki| BL:PDB:NREP 1 BL:PDB:REP 22->127|1c9hA|6e-13|34.6|104/107| RP:PDB:NREP 2 RP:PDB:REP 22->126|3chxA|1e-16|14.6|103/362| RP:PDB:REP 122->244|2a2kA|8e-15|15.7|121/171| RP:PFM:NREP 2 RP:PFM:REP 43->125|PF00254|1e-13|38.6|83/91|FKBP_C| RP:PFM:REP 134->237|PF00581|8e-06|34.3|99/108|Rhodanese| HM:PFM:NREP 2 HM:PFM:REP 32->125|PF00254|1.2e-25|41.5|94/96|FKBP_C| HM:PFM:REP 137->240|PF00581|1.1e-14|27.7|101/113|Rhodanese| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 2 RP:SCP:REP 22->127|1u79A|2e-16|32.7|104/125|d.26.1.1| RP:SCP:REP 130->241|1tq1A|2e-16|21.8|110/119|c.46.1.3| HM:SCP:REP 7->130|1fd9A_|7.9e-31|36.9|122/204|d.26.1.1|1/1|FKBP-like| HM:SCP:REP 126->246|1tq1A_|1.2e-15|26.9|119/119|c.46.1.3|1/1|Rhodanese/Cell cycle control phosphatase| OP:NHOMO 470 OP:NHOMOORG 329 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------1-1------------------------------1111-2------21221-----1111111-------------------111-----1-111-111111111111-111111111-1-111-1-11-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-11---1-11---------------1--1------------------------------------------------------------------------------1----1-----1111111------111111-11-1-1------1-------------11---1---11111---1111--------------31111121-11-1-1-------------------------1-------1---1--211112-223341311413--1---1-------------11-1111111-1111111111111111111-----11--------------------11-1----------------------------11---1-1122-111111113222213--111111111-111111-111---------1-11------11------------------1--221111--------1-------------------------------------1-- ----1-1-311322---11---------------11-------111------------1---1111121-2--11221121--------121-222-----1-1-1-13-156234-2-12232421314C3-324121141432-321231-411132--31132-2221---1-22-4---11---21111--212- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 227 STR:RPRED 91.5 SQ:SECSTR #####################ccccccEcccEEEcccccEEEEccccccccccTTccccccTTccTTccccccccccTTccccccEEEEccHHHHTTcGGGGccccccccEEEEcccccccEEEEcEEcTTccEEcHHHHHHHHTEEEEEEEcccHHHHHTccEETTcEEHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHHHTccTTcTcccccEEEETTHHHHHTTTcGGGcccc DISOP:02AL 245-248| PSIPRED cHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccccEEEEEEEEEEccccEEEcccccccEEEEEEccccccHHHHHHHHccccccEEEEEEcHHHHccccccccccccccEEEEEEEHHcccccccccccHHHHHHHHHHccccccccEEEEEcccEEEccEEEcccccccccccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHccccEEEEHHHHHHHHHHccccccccc //