[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : ffh
DDBJ      :ffh          signal recognition particle protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  898/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
a.24.13a.36.1b.65.1c.37.1
:452 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->420 2j289 PDBj 6e-94 43.8 %
:RPS:PDB   1->420 3dm5A PDBj 2e-36 31.9 %
:RPS:SCOP  4->90 1wgwA  a.24.13.1 * 3e-22 27.6 %
:RPS:SCOP  143->248 1f3uA  b.65.1.1 * 9e-24 21.4 %
:RPS:SCOP  298->420 1qzwA2  a.36.1.1 * 7e-32 31.7 %
:HMM:SCOP  1->94 1wgwA_ a.24.13.1 * 2.5e-24 44.7 %
:HMM:SCOP  92->298 1ls1A2 c.37.1.10 * 1.4e-49 38.3 %
:HMM:SCOP  298->431 1qzxA2 a.36.1.1 * 1.2e-43 47.0 %
:RPS:PFM   22->82 PF02881 * SRP54_N 5e-04 45.6 %
:RPS:PFM   100->295 PF00448 * SRP54 9e-34 37.4 %
:RPS:PFM   327->420 PF02978 * SRP_SPB 6e-17 48.9 %
:HMM:PFM   103->296 PF00448 * SRP54 3.6e-71 48.7 193/196  
:HMM:PFM   327->427 PF02978 * SRP_SPB 7e-34 45.5 101/104  
:HMM:PFM   5->82 PF02881 * SRP54_N 2.5e-18 37.3 75/75  
:BLT:SWISS 1->443 SRP54_RICFE e-103 47.7 %
:PROS 269->282|PS00300|SRP54
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21078.1 GT:GENE ffh GT:PRODUCT signal recognition particle protein GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(258831..260189) GB:FROM 258831 GB:TO 260189 GB:DIRECTION - GB:GENE ffh GB:PRODUCT signal recognition particle protein GB:PROTEIN_ID AAZ21078.1 GB:DB_XREF GI:71062075 GB:GENE:GENE ffh LENGTH 452 SQ:AASEQ MFENLTNKFEEIFSSLKKAPSLDEKQVDEGLRAIRQALLEADVSLDVAKDFIAKVKPKVLGQEIIRSTSPGDMVVKIVYDELVSLLGESNTDINLNAVPPVPMMLVGLQGSGKTTTTAKLAKYLEKNKKKKIMMVSLDVYRPAAQEQLRSLGEQNNILTLPIIEGQLPADICRRAVSAASLNGAEIILFDTAGRTQIDLQMMSEIKQIENIINPTETFLVADSLTGQVAAEVAKEFKNTVNLTGIVLTRADGDARGGAALSMKYVSQVPIKFLGVGEKIENLEVFHPDRIANRILGMGDIVSLVEKAAEDLGEENLKKAEENLKKGQFSMEDYLSQLRQMKKMGGIEGIMSFMPGVSKMKSQMDAAGIDESIITQNEAIILSMTKKERGNPKIIDGSRKKRIANGSGTDAATINKLLKQFKMMSEMMKKMSKGNLKGMSDKGIPPELLNQLK GT:EXON 1|1-452:0| BL:SWS:NREP 1 BL:SWS:REP 1->443|SRP54_RICFE|e-103|47.7|442/449| PROS 269->282|PS00300|SRP54|PDOC00272| COIL:NAA 29 COIL:NSEG 1 COIL:REGION 313->341| SEG 113->131|kttttaklakyleknkkkk| SEG 249->259|radgdarggaa| SEG 313->325|eenlkkaeenlkk| SEG 421->432|kmmsemmkkmsk| BL:PDB:NREP 1 BL:PDB:REP 2->420|2j289|6e-94|43.8|418/430| RP:PDB:NREP 1 RP:PDB:REP 1->420|3dm5A|2e-36|31.9|398/416| RP:PFM:NREP 3 RP:PFM:REP 22->82|PF02881|5e-04|45.6|57/74|SRP54_N| RP:PFM:REP 100->295|PF00448|9e-34|37.4|195/196|SRP54| RP:PFM:REP 327->420|PF02978|6e-17|48.9|94/101|SRP_SPB| HM:PFM:NREP 3 HM:PFM:REP 103->296|PF00448|3.6e-71|48.7|193/196|SRP54| HM:PFM:REP 327->427|PF02978|7e-34|45.5|101/104|SRP_SPB| HM:PFM:REP 5->82|PF02881|2.5e-18|37.3|75/75|SRP54_N| GO:PFM:NREP 8 GO:PFM GO:0005515|"GO:protein binding"|PF02881|IPR013822| GO:PFM GO:0005525|"GO:GTP binding"|PF02881|IPR013822| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF02881|IPR013822| GO:PFM GO:0005525|"GO:GTP binding"|PF00448|IPR000897| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF00448|IPR000897| GO:PFM GO:0006614|"GO:SRP-dependent cotranslational protein targeting to membrane"|PF02978|IPR004125| GO:PFM GO:0008312|"GO:7S RNA binding"|PF02978|IPR004125| GO:PFM GO:0048500|"GO:signal recognition particle"|PF02978|IPR004125| RP:SCP:NREP 3 RP:SCP:REP 4->90|1wgwA|3e-22|27.6|87/99|a.24.13.1| RP:SCP:REP 143->248|1f3uA|9e-24|21.4|103/118|b.65.1.1| RP:SCP:REP 298->420|1qzwA2|7e-32|31.7|123/138|a.36.1.1| HM:SCP:REP 1->94|1wgwA_|2.5e-24|44.7|94/0|a.24.13.1|1/1|Domain of the SRP/SRP receptor G-proteins| HM:SCP:REP 92->298|1ls1A2|1.4e-49|38.3|206/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 298->431|1qzxA2|1.2e-43|47.0|134/138|a.36.1.1|1/1|Signal peptide-binding domain| OP:NHOMO 2329 OP:NHOMOORG 1153 OP:PATTERN 22222222111222222222222222222222222222222222222222222222222222222-22 2222211211111222222-22221122222222221222122222122222222222222222222222222222222222223222222222222--222222222221221222222222222222222222222222---2222222222222222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222132222221222222222222222222222122222222222222222222222222222222222222222222232222222222222222332222223222222233222222222223222222222222222222222222222222222222222-22222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222212222222222222222222222222222222222222222222222222222222222222232222233322222222222222232222222222222222222222222222222222-2222222222222222222222222222-2222222222222222222222222222222222222222222222222122222222222222222222222222222222222222222222222222212222222222222222222222222222222222222222222222232222222222222222222------2222222221222222-22222222222222222222222322222222 2222213-422111222222222222222111122111111111113211222211111111211121122-1211111111112222-21122221112121222111511311121111-1-22-1-151-1211-111-1111111111132233112-11221213711223434s33444569A1654432223 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 420 STR:RPRED 92.9 SQ:SECSTR ccTHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHccccTTccHHHHHHHHHHHHHHHHTTcccccccccccccEEEEEEccTTccHHHHHHHHHHHHHTTTcccEEEEEcccccTHHHHHHHHHHGGGTcEEEccTTcccHHHHHHHHHHHHHHTTccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEEGGGGGGHHHHHHHHHHccTTEEEEEEcccccccHHHHHHHHHTTcccEEEEEccccTTcEEEccHHHHHHHHTTTTcHHHHHHHHHHHTTHHHHHHHHHHHHTTcccHHHHHHHHHHHHTTccccccHHHHHccccccGGGcccccTcHHHHHHHHHHTTccHHHHHcGGGccHHHHHHHHHHHTccHHHHHHHHHHH################################ DISOP:02AL 9-20, 313-314, 354-371, 423-452| PSIPRED ccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccEEcccccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHcccHHHHHHHHHHHHHccHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHccccccHHHHHHcc //