[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Candidatus Pelagibacter ubique HTCC1062 (pubi0)
Gene : folD
DDBJ      :folD         methylenetetrahydrofolate dehydrogenase
Swiss-Prot:FOLD_PELUB   RecName: Full=Bifunctional protein folD;Includes:  RecName: Full=Methylenetetrahydrofolate dehydrogenase;           EC=1.5.1.5;Includes:  RecName: Full=Methenyltetrahydrofolate cyclohydrolase;           EC=3.5.4.9;

Homologs  Archaea  27/68 : Bacteria  887/915 : Eukaryota  185/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:281 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->274 1b0aA PDBj 2e-71 49.3 %
:RPS:PDB   2->278 1b0aA PDBj 2e-48 46.6 %
:RPS:SCOP  2->144 1edzA2  c.58.1.2 * 1e-35 21.4 %
:RPS:SCOP  121->278 1a4iA1  c.2.1.7 * 1e-22 49.7 %
:HMM:SCOP  1->120 1a4iA2 c.58.1.2 * 2.1e-39 55.8 %
:HMM:SCOP  121->281 1a4iA1 c.2.1.7 * 1.2e-48 44.1 %
:RPS:PFM   2->119 PF00763 * THF_DHG_CYH 2e-28 56.8 %
:RPS:PFM   123->279 PF02882 * THF_DHG_CYH_C 4e-48 55.4 %
:HMM:PFM   122->279 PF02882 * THF_DHG_CYH_C 6.2e-69 60.1 158/161  
:HMM:PFM   3->119 PF00763 * THF_DHG_CYH 4.7e-43 52.6 116/117  
:BLT:SWISS 1->281 FOLD_PELUB e-159 100.0 %
:PROS 257->265|PS00767|THF_DHG_CYH_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAZ21128.1 GT:GENE folD GT:PRODUCT methylenetetrahydrofolate dehydrogenase GT:DATABASE GIB00256CH01 GT:ORG pubi0 GB:ACCESSION GIB00256CH01 GB:LOCATION complement(303706..304551) GB:FROM 303706 GB:TO 304551 GB:DIRECTION - GB:GENE folD GB:PRODUCT methylenetetrahydrofolate dehydrogenase GB:PROTEIN_ID AAZ21128.1 GB:DB_XREF GI:71062125 GB:GENE:GENE folD LENGTH 281 SQ:AASEQ MILIDGKKIAAELREQLRQEVVELKAKHNKIPGLTVILIGEMAPSQIYVRMKEKAANEVGLKSEVIRYPEAVEEKTVLDKIEELNKDESISGILVQLPLPKHIDKQKVIETILPGKDVDGFHPMNVGNLSSGYESSVPCTPLGCYLMIKKIEPNLSGKKAVMIGRSNLNGKPMAQLLLKENCTVTITHSKTKDLKAECLEADIIVAAVGIPELVKADWVKKDAIVIDVGINKTENGIVGDVAFEEVSKVARALTPVPGGVGPMTIACLLKNTIECFKRSQK GT:EXON 1|1-281:0| SW:ID FOLD_PELUB SW:DE RecName: Full=Bifunctional protein folD;Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; EC=1.5.1.5;Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; EC=3.5.4.9; SW:GN Name=folD; OrderedLocusNames=SAR11_0307; SW:KW Amino-acid biosynthesis; Complete proteome; Histidine biosynthesis;Hydrolase; Methionine biosynthesis; Multifunctional enzyme; NADP;One-carbon metabolism; Oxidoreductase; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->281|FOLD_PELUB|e-159|100.0|281/281| GO:SWS:NREP 9 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| PROS 257->265|PS00767|THF_DHG_CYH_2|PDOC00616| BL:PDB:NREP 1 BL:PDB:REP 3->274|1b0aA|2e-71|49.3|272/287| RP:PDB:NREP 1 RP:PDB:REP 2->278|1b0aA|2e-48|46.6|277/287| RP:PFM:NREP 2 RP:PFM:REP 2->119|PF00763|2e-28|56.8|118/118|THF_DHG_CYH| RP:PFM:REP 123->279|PF02882|4e-48|55.4|157/160|THF_DHG_CYH_C| HM:PFM:NREP 2 HM:PFM:REP 122->279|PF02882|6.2e-69|60.1|158/161|THF_DHG_CYH_C| HM:PFM:REP 3->119|PF00763|4.7e-43|52.6|116/117|THF_DHG_CYH| GO:PFM:NREP 4 GO:PFM GO:0003824|"GO:catalytic activity"|PF00763|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF00763|IPR000672| GO:PFM GO:0003824|"GO:catalytic activity"|PF02882|IPR000672| GO:PFM GO:0009396|"GO:folic acid and derivative biosynthetic process"|PF02882|IPR000672| RP:SCP:NREP 2 RP:SCP:REP 2->144|1edzA2|1e-35|21.4|140/146|c.58.1.2| RP:SCP:REP 121->278|1a4iA1|1e-22|49.7|155/160|c.2.1.7| HM:SCP:REP 1->120|1a4iA2|2.1e-39|55.8|120/125|c.58.1.2|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 121->281|1a4iA1|1.2e-48|44.1|161/170|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1580 OP:NHOMOORG 1099 OP:PATTERN ------------------11111-21111111-----------11-1111111--------111--11 1111211111111111111-11111111111111111222122111111111221111112221222211111111111112311111111111111--1111111111111111111111111111111111111111111121111111111111111111111111111111111111112211111121111111111111111111111111111111111111111211111111111111111111111111111221111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111222111211111111111111111111111111111111111111111111111-1-------1211311122211322111111121111313111111111111-11111111111111111111111111111111112311112211111111111111121111111111111111112111111111111111111111-1111111111111111111111111212122111111122111111111111111111111111111111111112111111111111111111111111-1111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111121111111111111112111111111111332211122211111111121111111111111111111111111111111111111111111111111----1-111-111---111111---1111111111111 ----331-311-12211-1-111111111111111111111111111122322222111222233333233232333-3333333233-111112211113-1434-16245747643443443764F2Jc5-7563442624553432353354553333223242633D21121333Y222216364-431133333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 98.6 SQ:SECSTR #EEccHHHHHHHHHHHHHHHHHHHHHTTccccEEEEEEEcccHHHHHHHHHHHHHHHHHTcEEccEEEcTTccHHHHHHHHHHHHTcTTccEEEEcccccTTccHHHHHTTccTTTcTTcccHHHHHHHHTTccccccHHHHHHHHHHHHTTcccTTcEEEEEcccTTTHHHHHHHHHTTTcEEEEEccccccHHHHHHHccEEEEccccTTcccTTTccTTcEEEEccEEcTTccEEccccHHHHHHHccEEcccccccHHHHHHHHHHHHHHHHHH### PSIPRED cEEEEHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHccHHHccccccHHHHHHHHccccccccccHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHcccEEEEEcccccHHHHHHccccEEEEEccccccccHHHcccccEEEEEEEEEEccccEEEccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcc //